KEGG   Paramecium tetraurelia: GSPATT00000886001
Entry
GSPATT00000886001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00100  Steroid biosynthesis
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    GSPATT00000886001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     GSPATT00000886001
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 Spatacsin_C
Other DBs
NCBI-GeneID: 5024355
NCBI-ProteinID: XP_001438570
Genoscope: GSPATT00000886001
UniProt: A0CK56
Position
undetermined
AA seq 375 aa
MQVNSTFGIMQESTWDSVCFALKWQIAYFIYMFAATKLLPGKEFKGFPDPKGKVLMYKIN
GLYTLILTLALIFLGKVFFNFTLIPLIEHFWSFFIASNILAFLFSFILLIKGKLSLHYKP
HIQSWTPQLLNDWWFGSEQNPRILNVDLKMYFYEPSLIGLQIFLLSFAEYQYNTYSILSI
NMILFQVFWFMWLITHYIREDFMLSTWDIIAENFGFMLVWGDIVYLPYLYCIGGWYLGDF
VQNSSTVYLIFITLLHFASLYMYRDANWQKDRYRRQGDKAIIWKKKPQTLQNKLLISGWW
GIGRHLNYTGEILVYLSIAMCGEFKAFNNYILPLSLFCLLTHRATRDDKRCREKYGKLWQ
EYCEIAKFKIIPFIF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcaagtgaatagtacatttgggataatgtaggaatccacttgggattctgtgtgtttt
gcactcaaatggcaaatagcatactttatctacatgtttgcagccacaaagctcttgcca
ggaaaagaattcaaagggtttccagatccaaaagggaaagttctgatgtataaaatcaat
ggattatataccttaatactaacactcgcactcatatttttgggtaaagtgttttttaac
ttcacattgattccattgatagaacacttttggtccttttttatagcctcaaatattttg
gcttttctgttttccttcattttattgataaaaggaaaattgagtctacactacaaaccc
catattcaatcatggacaccttaactattgaatgactggtggtttggatcagaatagaat
ccacgtattttaaacgtagacctcaaaatgtatttttacgagccatcattgatcggatta
caaatattcttattatcatttgctgaataccaatacaatacttattccatattatccata
aacatgatactattttaagtattttggtttatgtggcttatcacacactatataagagag
gattttatgttatcgacttgggatattatcgctgaaaattttggatttatgttagtttgg
ggagacatcgtttatttaccttacctatattgtattggtggttggtacttgggcgacttt
gttcagaatagttctactgtctatctgattttcatcacgttgttgcactttgcttcattg
tatatgtacagagatgcgaattggcagaaggatagatatagaagacaaggggataaagcc
ataatttggaagaaaaaaccttagaccctatagaataagttattaattagtggttggtgg
ggtatagggagacatctcaattacacaggggaaattttagtttatctatctattgccatg
tgtggggaattcaaagcttttaacaattatatcttgcctttgagtttattctgtctattg
acacacagggcaacaagagatgacaagcgttgtagagaaaaatatggtaagctgtggtaa
gaatattgtgagattgccaaattcaagattattccattcatattttga

DBGET integrated database retrieval system