KEGG   Paramecium tetraurelia: GSPATT00002641001Help
Entry
GSPATT00002641001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00640  Propanoate metabolism
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00002641001
   00640 Propanoate metabolism
    GSPATT00002641001
Enzymes [BR:ptm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     GSPATT00002641001
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GSPATT00002641001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 5038423
NCBI-ProteinID: XP_001452638
Genoscope: GSPATT00002641001
UniProt: A0DQC4
Position
undetermined
AA seq 312 aa AA seqDB search
MIGKQIFRAFSSTTAPYVWVNKHTKVICQGITGNQGTFQTEQALNYFTKMVGGVSPKKAG
STHLGLPVFKDCQEAKSATGCDASVIYVPPPTAASAIIEAIEAQIGLVVVITDGIPQHDM
IKVKHALRSQSVTRVIGPNCPGIIKPNECKIGIMPGYIHQNGKIGIVSRSGTLTYEAVDQ
TTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGENEEMAADWIKK
NNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGIRVVKSPAQIGK
TMLEVMKEKGLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaaataaatctttcgtgcattttcatcaaccacagctccatatgtgtgggtc
aataagcacaccaaagtgatatgctaaggtatcactggtaattagggcacattctaaact
gaataagcattgaactactttacaaaaatggttggtggagtgtcacctaagaaggctgga
agtactcatcttggcttacctgttttcaaggattgccaagaagccaaatcagccacagga
tgtgatgcatctgtgatctatgtgcctcctcctacagcagcatcagccattattgaagcc
attgaggcataaattggcttagtggttgtcattactgatggaattccttaacatgatatg
attaaagttaagcatgctctaagatcctaatcagttacacgtgttatcggacctaattgt
ccaggaattatcaagccaaatgaatgtaaaattggtatcatgccaggatacattcattaa
aatggaaagattggtattgtctctagatctggtactcttacatatgaggctgtcgatcaa
actacaagagctggtttgggacaatcaacagtcgttggtattggtggagaccctttcaat
ggaactaactttattgatgttttggagagattcatggttgatccagaaacagagggtatt
gttatgatcggagaaatcggtggagagaatgaggaaatggctgctgattggatcaagaaa
aataatcctaaaaataaaccagttgttggatttattgctggtatcacagcaccacctgaa
agaagaatgggacatgcaggagctattgtgtcaaagggcaagggaagtgcacctgaaaag
attagagcacttgaataagcaggtattagagttgtgaaatcacctgcttaaattggtaaa
actatgttggaagtcatgaaagaaaaaggattagcatga

DBGET integrated database retrieval system