KEGG   Paramecium tetraurelia: GSPATT00003396001Help
Entry
GSPATT00003396001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptm01002]
    GSPATT00003396001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     GSPATT00003396001
Peptidases [BR:ptm01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   GSPATT00003396001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49 ABC_tran_Xtn DUF1722
Motif
Other DBs
NCBI-GeneID: 5043709
NCBI-ProteinID: XP_001457932
Genoscope: GSPATT00003396001
UniProt: A0E5G8
Position
undetermined
AA seq 703 aa AA seqDB search
MDQQKAPIISLEAKVSAIECPAFNLLDEKSKHYAYYFTRACWAGAKICYFQRSYEAPGLF
YLLQKIFQKESTTEVRDKLLANEFTENQVQQLYTYISAFFQNCGNYLSFGDSKFVPELPV
EKFQQFLQLSKAYQEQQDEFTKIWNLIEKYIYSYEKPYGLLDLLEKGGSNSYYSPNLSKE
FIEELDQFLHKQNLSELNTRVILKEDRVELLVASSERSDVVELGEVKGKKVFAIYGDFKS
FLNGVATNLREAQKYAANETQVKMLEEYIKHFQSGDIEQHKESQKHWIQDKGPIIETNIG
FIETYLDPMKVRAEYEGFVSIVNQEESKLLGNLVEKAEDIIKDLPWPKEFEIEKFSRPDF
TSLEILAFACSGTPVGINIPNYDDIRQNLGFKNVNLGNVYGKPNRDSVRFLQGTDIDLFI
NYYKESLFVVVALHELIGHGSGKIFMEDKDGKLNFENVTNPFTNEKVTTFYKPNEHWHAK
FGELSGAYEECRADSVALYLSTYDDVVQILVPGKTKEERDEIVKAAWLDIIMGALKGLQY
YSAEQSKWGQPHILASYVILQSIIQKDPSFVQFVHSEFNNKPYFTVQVDYSKIWTVGKEA
IADLLKGLQVYKSVADGENGMKFFNKFTQVDQKFLQLREIVLAHKQPRKIELQPDVKLNN
GQVELVVFPESHEGVIQSHIFHYQQDVEDVKQEFLDRQQYFKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggattaataaaaagcaccaataatatctttagaggctaaggtatctgcaattgaatgt
ccagcgttcaatttactagatgagaaaagcaagcattatgcctactatttcacaagagct
tgttgggcaggtgcaaagatttgttacttttaaagatcatatgaggcgccaggattattt
tatttgttgtaaaagatattttagaaggaatcaacaacagaagttagggataagttgttg
gccaatgaattcactgaaaactaggttcaataattatatacctatatctctgcatttttc
taaaattgtggaaattacctaagctttggagactcaaagttcgttcctgaattacctgta
gaaaaattccaataattcttacaattatcaaaggcatattaagaacaataggatgagttt
acaaaaatatggaatttaatagaaaaatatatttattcatatgagaaaccatatggatta
ttggatttacttgagaagggaggatctaattcttattactctccaaacttgagtaaggaa
tttatagaggaattggattaattcttgcataaacaaaacttaagtgaattgaatactaga
gtgattttgaaggaggacagagtggaattattggtagcttcatcagagagatcagatgtc
gttgaattgggtgaagtgaaaggaaagaaagtattcgctatctatggtgactttaaatct
ttcttgaatggagtggccactaatttaagagaggcacagaagtatgctgccaatgagact
taagttaagatgttggaggaatacattaaacatttctagagtggagacattgagtaacat
aaggagagttagaaacattggattcaagacaagggaccaattattgagacaaatattggt
tttattgaaacctacttagacccaatgaaggtgagagcagaatatgaaggatttgtatcc
attgtgaattaggaggaatccaagttgcttggaaatttagttgaaaaggcagaagatata
atcaaggatttgccttggccaaaggagtttgaaattgaaaagttcagcagacctgacttt
acttcattagaaatattggcatttgcttgttctggcacaccagttggaatcaacatacct
aattatgatgacattagatagaatttaggattcaagaatgttaacttaggaaatgtctat
ggaaaaccaaatagagattcagttagattcttatagggaacagacatcgacttgttcatt
aactattacaaagaatccttgtttgtcgtcgttgcattacatgagttgattggacatgga
agtggcaagatctttatggaagacaaagatggaaaattgaattttgagaatgttaccaat
ccattcaccaatgaaaaagtgacaacattttacaaaccaaatgaacattggcatgctaaa
tttggagaattgtcaggtgcctatgaagaatgcagagctgatagtgtagccttgtatctt
agtacctatgatgatgtagtgtaaattctagtgcctggaaaaacaaaagaagaaagagat
gaaattgtcaaggctgcttggttagacatcatcatgggagcattgaaaggacttcaatat
tattcagctgaataatcaaaatggggataaccacacatcttggcttcctatgtgattctg
taatcaatcatatagaaggacccatctttcgttcaatttgtccattcagaatttaacaat
aaaccttactttactgtttaagtggattacagtaaaatctggactgttggcaaagaagct
attgctgacctcttaaaaggcttataagtctataagtcagtagctgatggagagaatggc
atgaaattcttcaataaattcactcaagtcgatcaaaagttcctttaactcagagaaatc
gttttggctcacaaataaccaagaaagattgagctataaccagatgttaaattaaataat
ggataagtagaactagtagtcttcccagaatcacatgaaggtgttattcaatcacatata
ttccattattaataggatgttgaggatgttaagcaagagtttttggatagataataatat
tttaagaattga

DBGET integrated database retrieval system