KEGG   Paramecium tetraurelia: GSPATT00004065001Help
Entry
GSPATT00004065001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    GSPATT00004065001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptm03041]
    GSPATT00004065001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     GSPATT00004065001
Spliceosome [BR:ptm03041]
 Complex C
  Other components
   Step II factors
    GSPATT00004065001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 Flavi_DEAD AAA_30 T2SSE ATPase SRP54 AAA_16 AAA_29
Motif
Other DBs
NCBI-GeneID: 5046378
NCBI-ProteinID: XP_001460593
Genoscope: GSPATT00004065001
UniProt: A0ED29
Position
undetermined
AA seq 1111 aa AA seqDB search
MNQLLQLQYISLCSRVLQELENHTGIKDKVLAEYIIDLGRQSKDEKEFKQKLDAAKADFT
DQFTNSLFNIIKKMSPQEKKQVEQPPQIEVVVKEQKFPGLALPNREVVQLEDMEEQSRSR
SLSKNKKKKKDKKKKKDKNKDKDKEKEREKEKEKEKEKKDKKESSASPQRTHRDIEKGHI
YEGVVTKVQDFGVFVQIAGFKGRKEGLVHISNIREKRVTNPFDILKRNQKVFVKVISIVN
EKIALSMRDVDQNSGQEIEKKAKAMNEYDQVIKQQEQSKDNNRYGAITGVKLDLAQDACK
KKAKRIASPDLWEKTRLEYNSKLVRQIDNKAIVEDSESEGFVSDSEDLEIDMNDYEPPFL
KGQTTKAGINLSPIRVVKNPEGTLQREALHAQQLARERREMREQQQRAINEQNRDKYRED
PLAQISGNMNQMQVEIPEWKKEAMFKSSVRNRTHMSIKEWRESLPIYNFKNELLAAIKEN
RILIVIGETGSGKTTQITQYLMEAGYGRNGMKIGCTQPRRVAAMSVAKRVAEEMGVQLGD
EVGYAIRFEDCTGPNTIIKYMTDGMLLREALIDKDMSQYSVIMLDEAHERTINTDVLFGL
LKQVVAKRNDFTLIVTSATLDAEKFSSYFFNCKIFRIPGRNFPVEVFFTNEPEEDYLEAA
QLCVIQIHLEEPAGDILLFLTGQEEIDTACQVLHERMKKLGPDAPELIILPVYSALPTEL
QQKIFDPAPSGARKIVIATNIAEASITIDGIYYVVDPGFSKIKVYNPKLGMDSLIIAPIS
QASAQQRAGRAGRTGPGKCYRLYTESAFNTEMLPTSVPEIQRTNLANTILLLKAMGIHDL
LNFDFMDPPPVQTMIAAMEQLYALGALDDEGLLTKVGRKMAEFPLEPPQAKMLLTAVDLG
CVDEIITIIAMLSEPNIFYRPKDRQQLADQKKARFSQTRRRSFDFKNNFSNVWCHENYIQ
ARSMRRAQDVRKQLLQIMERYKFQITSCGKDFWKIRKAITAGYFFHVAKKDQAEGYKTLS
DNQQVYIHPSSALFNKGPLWCVYHELVMTSKEYMREVCEIEPRWLIEVAENYFKAHNQMG
QLSKTKKSEKLDPLSCKFGDANAWRLSKRKG
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgaattagttgctgcaattataatacatatcattatgctccagagtgctataagaatta
gaaaatcacacagggataaaggataaggtgttggcagaatatataatagatttaggcagg
taaagcaaagatgaaaaagaatttaaataaaaattggatgctgccaaagctgattttaca
gattaatttacgaattctttattcaatatcatcaagaagatgtcaccttaagaaaaaaag
taagtagaacagccaccataaatagaagtggtagtaaaagaacagaaatttccaggatta
gcattaccaaatcgcgaagtagtttaattagaggacatggaagaataatcgcgatcaagg
tcattatcaaaaaataagaagaagaagaaggataagaaaaagaagaaggacaaaaataag
gacaaggataaagaaaaggaaagagaaaaagaaaaagaaaaggagaaggagaaaaaagat
aagaaagaatcatctgcatcaccatagaggactcatagagatatagaaaaaggacatata
tatgagggtgtagtaacaaaggtgtaggattttggagtttttgtgtagatagcaggtttt
aaaggcagaaaggaaggtttagtccatatttccaatataagagagaaaagggtgaccaat
ccttttgatattttgaaaagaaattagaaggtgtttgttaaagtgattagtattgtgaat
gagaagattgcattgtcaatgagggatgtggattaaaatagtggttaagagatagagaag
aaagctaaggcaatgaatgaatatgatcaagtgattaaataataagagtagagtaaggac
aataatagatatggagcaataacaggagtcaaattggatttagcataggatgcttgtaaa
aagaaagctaagagaattgcatctccagatttatgggagaagactagattggaatacaat
tcaaaattggttcgttagatagacaataaagctattgtggaagattcagagtcagaaggt
tttgtttcagactctgaagatttggaaatagatatgaatgattatgaacctcctttttta
aagggataaacaacgaaggcagggataaatttatcaccaattagagttgtgaaaaatcca
gaaggaactttgtaaagagaggccttacatgcttaatagttggcaagggaaaggagagaa
atgagagaataacaataaagagcaataaatgaatagaatagagataaatacagagaggat
cctttagcttagatttcaggaaatatgaattagatgtaagtagaaattcctgagtggaag
aaagaagcaatgttcaaatcaagtgtaagaaatagaacacatatgagtattaaagaatgg
agagaatctttaccaatttataatttcaagaatgaattgttggctgccattaaagagaat
cgtattctcatagtaattggagaaacaggtagtggtaaaactacttagatcacataatat
ttaatggaggctggatatggtagaaatggaatgaagataggttgcacttaacctagaaga
gtggcagcaatgtcagtggcaaaaagagtggcagaagaaatgggagtgtaacttggagat
gaagtaggttatgcaataagatttgaagattgcacaggtcctaatacaattattaagtat
atgactgatggaatgttactaagagaagcattaatagataaagatatgagtcaatatagt
gttattatgttagatgaggcacatgagagaacaattaatactgatgtgttatttggatta
ttaaaataagttgttgctaaaagaaatgatttcacattaattgtaacatcagccactttg
gatgctgaaaagttttcttcttatttttttaattgcaagatatttagaatcccaggacgt
aactttcctgttgaagtgtttttcacaaatgaacctgaagaagactatttagaagctgcc
taattgtgtgtaatttagattcacttagaagagccagctggcgatattctattgttttta
acaggacaagaagaaatagatacagcatgctaagtgcttcatgaaagaatgaagaagtta
ggcccagatgctcctgaattgattattttaccagtttattctgctttacccacagaatta
caacagaagatttttgaccctgccccttcaggagccagaaagatagttattgctactaat
attgccgaagcctcaatcactattgatggaatttattacgtggttgatccagggttctct
aaaatcaaggtatataatccaaaattgggtatggattcattaattattgctccaatcagt
caagcatccgcataataaagagcaggtagagcaggaagaactggtccaggaaaatgctat
agattatatactgaatcagcatttaatacagaaatgttacccacttcagtacctgaaata
tagagaactaatttagcaaatacaattttattattaaaagctatgggaatacatgatctt
ttgaattttgactttatggatcccccacctgttcaaactatgattgcagctatggaataa
ttgtatgcattgggagctttggatgatgaaggattgttaacaaaagtaggtaggaagatg
gcagaattccctttggaaccacctcaagctaaaatgttattgactgcagttgatttagga
tgtgtcgatgaaatcattacaattatagcaatgttatcagaaccaaacatcttctacaga
cctaaagacagataacaattagcagattagaaaaaggccagattttcatagaccagaagg
agatcatttgactttaaaaacaattttagtaatgtgtggtgtcatgaaaattatatctaa
gcaagatccatgagaagagcctaagatgttagaaaacaattattataaattatggaaagg
tataaattccaaattacatcttgtggtaaagacttctggaaaatcagaaaagctataact
gctggttatttcttccatgttgctaagaaggatcaagcagaaggttataaaactttatct
gataatcaataagtctatatccatcctagtagtgccttgttcaacaagggacctctctgg
tgtgtatatcatgagctggtcatgacatccaaagaatatatgagggaagtttgtgaaata
gaacctaggtggttaattgaagttgctgaaaattatttcaaggctcacaatcaaatggga
taactctcaaaaacaaagaaatcagagaagctggatccattaagctgcaaatttggagac
gcaaatgcatggagactaagtaagcgtaaaggttga

DBGET integrated database retrieval system