KEGG   Paramecium tetraurelia: GSPATT00005327001Help
Entry
GSPATT00005327001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K14565  nucleolar protein 58
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    GSPATT00005327001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ptm03009]
    GSPATT00005327001
Ribosome biogenesis [BR:ptm03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    GSPATT00005327001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT Csd3_N
Motif
Other DBs
NCBI-GeneID: 5013759
NCBI-ProteinID: XP_001427975
Genoscope: GSPATT00005327001
UniProt: A0BPW0
Position
undetermined
AA seq 455 aa AA seqDB search
MLILIETPAGFALFQVANTKALSKIDNIYDYLQNEKQAKKLITPFAFQQFKDTQEALVAT
SKLINGKIPKKLSKFLEKNVISQEVQDQIAVQDKKLAKQIQDQLGLTCVQTPVTEQLFRG
IKSQLTNLIEGLSEAELKNMTLGLAHGLSRYKLKFSTEKVDTMIIQAIALLDDLDKEINN
YMMRLREWFGWHFPELGKIITDNLIYAKVVKAIGMRIKTSQTDLSGILPDNLEADVKQAA
EVSFGTEITLEDEKFILCLADQVIELTDYRAQLSEMQAIAPNLTTMVGELVGARLISHAG
SLVNLAKYPASTVQILGAEKALLKAIRTKHNTPKYVGSAPAKLKGKVSRTLAAKTALCIR
YDALGEGQDAEFGVTNKAFLEKRVHQLEEGVNYRDVKAPQRGKAKPVSNQAQYQEEADFQ
PQGASWMQKFQKGEDKRQASQDLAQNSKFKKVKQQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttaatattaatcgagactcctgcaggatttgccctcttttaagttgctaacactaag
gcacttagcaaaattgataatatctacgattacttgcaaaatgagaagcaagctaaaaaa
ttgattaccccttttgctttccaacaatttaaggatacataagaagctctcgttgccact
agtaagcttattaatggtaagatccccaagaaactcagtaagtttttggaaaagaatgta
atttcacaggaagtttaagattaaattgcagtttaagataaaaaactagctaaacagatt
caagattaactgggattgacttgcgtttaaaccccagtcacagaacaactctttagaggc
attaaatcacaactaaccaatttaattgaaggcttaagtgaagctgaactcaaaaacatg
actttgggtttggcacatggtctatctagatacaagctcaaattttcaactgaaaaagta
gacaccatgatcatccaagctattgcacttttggatgatttagacaaagaaattaacaat
tacatgatgagattgagagaatggttcggatggcattttccagaattaggcaaaatcatt
acagataacctaatatatgctaaggttgttaaagccattggtatgagaatcaagacaagc
tagactgatctttctggcattttaccagacaatctagaagcagatgtcaaataggctgca
gaagtgtcttttggtactgaaatcacacttgaagatgaaaagttcattctctgtttggct
gactaagtcatcgaattgactgattacagagcctaattatcagaaatgtaagctatcgcc
ccaaatcttacaactatggttggagaattagtaggagcaagattgatatctcatgctgga
tctctggttaatctagctaaatacccagcttctacagtataaatcttaggagcagagaaa
gcactgttaaaagccattagaaccaaacacaacacaccaaaatatgttggaagtgctcct
gctaaattgaaaggtaaagtctccagaacattagctgctaaaactgccttgtgtattaga
tatgatgctttaggtgagggataagatgctgaatttggagtcaccaacaaagcattctta
gaaaagagagttcattaattagaggaaggagtgaactatagagatgtgaaagcaccataa
agaggaaaagccaagccagtttccaattaagcttaatattaagaagaagcagacttctaa
ccttagggagcctcatggatgtagaaattccaaaaaggtgaagataaaagataggcctca
taagatttagcataaaattcaaaattcaagaaggtgaaatagtaatga

DBGET integrated database retrieval system