KEGG   Paramecium tetraurelia: GSPATT00006336001
Entry
GSPATT00006336001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptm01009]
    GSPATT00006336001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     GSPATT00006336001
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 SPARC_Ca_bdg EF-hand_8 EF-hand_4 Caleosin EF-hand_9
Other DBs
NCBI-GeneID: 5019019
NCBI-ProteinID: XP_001433234
Genoscope: GSPATT00006336001
UniProt: Q867N3
Position
undetermined
AA seq 169 aa
MGNGQGMEEQMGTFQPQEIKRLYKRFQFLDKDGSGQLEPSELFDVPELSQNPLVKRVFQI
FDKDNDGKISFAEFITGLSSLYGNDEEEKLKFMFKIYDIDQDGFITNGELFKVLQMMVGN
NLTDVQLQQLVDRTIIKADEDFDSKISFAEFKKMVKDLDVASKLQMQGV
NT seq 510 nt   +upstreamnt  +downstreamnt
atgggaaatggtcaaggaatggaggagtagatgggtacattctaacctcaagagattaaa
agactttacaagagatttcaattcttagataaagatggttctggttagttagaaccatct
gaattgtttgatgttcctgagctatcacaaaatccattagtgaaaagagtgtttcaaata
tttgataaggataatgatggtaagataagttttgctgaatttatcactggactgtccagc
ttgtatggtaatgatgaagaggagaagttaaaatttatgtttaaaatttatgatatagat
taagatggatttattacaaacggagagttattcaaagtgctttaaatgatggttggaaat
aatttaactgatgttcaattacaacaattagtcgatagaactataatcaaagcagatgaa
gactttgattctaagatttcctttgcagaatttaagaaaatggttaaagacttagatgtt
gcttctaaactctaaatgtaaggagtttga

DBGET integrated database retrieval system