KEGG   Paramecium tetraurelia: GSPATT00007090001Help
Entry
GSPATT00007090001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08582  calpain-15 [EC:3.4.22.-]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptm01002]
    GSPATT00007090001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     GSPATT00007090001
Peptidases and inhibitors [BR:ptm01002]
 Cysteine peptidases
  Family C2: calpain family
   GSPATT00007090001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 HAP2-GCS1
Motif
Other DBs
NCBI-GeneID: 5022061
NCBI-ProteinID: XP_001436276
Genoscope: GSPATT00007090001
UniProt: A0CDL2
Position
undetermined
AA seq 794 aa AA seqDB search
MLSYQLFNKISKMSSDSLIQEALSQFIMLRSPRELLHEFKTQALNLEQIRQLVQVFDPNI
SNEDIKYFYLKVITKFKSPAGITEDIYQQIVDDEEFTLRGGSQNSYDSLPLLKNIIRGVR
EKKVPIQRLYNFYDKNKDKELQDPEFRNLLEFFYVAITDAQFKKLREEFPDNPLSESAIV
SLFEKWQEIVFENTQGDPQIILEAPSKTSNLLTIPKPQQTISLELTREEDERFKDFMGVD
FKIPGVKELADLQKRCQQTQEIFTDPDFPPNVTSLGPKFSANNWKRLQELFQGEQKVFSI
DTQHDKSGVGLNKWISHRDICQGDLGDCYFMSTLSSIACKWPDQIKDLFPIQRANKFGVY
GVKMCINGEWKVIPIDDNIPVKNGKIAFTKNADKEIWVSLLEKSWAKVNGSYTNIDAGDP
REVIKTITGGPVWLLLTNKPNFKENFITCVKQKCVMVTGTYSKNADYSAIGLEPGHAYSI
LNVKTVNHPQRGQVHLLKIRNPWARKEWKGDWSDESDLWTPELREQAGNTGKENDGIFFM
SLDDYTKYFFSVFCGYFKTDYIYNSMRFNVRRNKGVYFEFEIKKEGEYFFAIHQESTRQY
RSQPELKYEYSYVRLLLAKELQNGYEYLEGKFYKDIETHVGRVGENFTPGKYILYIKIKW
HVPSWNEHSVVLSTYGEQYVQLKEVPRDPNLVSQTMMHQVRSNNKVEEVLPGITMKMDNN
GNLGIGYIYYKNESNQQVNFETNLVNKGGCKLTKPERGYYFKSFIPPQGERLVTFTITPP
ITELSMPTLSHKLL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgttaagttactaattatttaataaaatatctaaaatgagctcagattcgttaattcaa
gaagctctatcttaatttattatgctaagaagcccaagggaattgttgcatgaatttaag
acctaggctttgaatttagaatagataagatagctagtgtaagttttcgatccaaatatc
tctaatgaagacataaagtacttttatctgaaggtgattaccaaattcaaaagccctgca
ggaataacagaggatatttatcaataaatagtggatgatgaagaatttacattgagagga
ggatcataaaattcttatgattctttaccattgttaaagaatatcattagaggagtgaga
gaaaagaaggtgcccatatagagattgtataatttctatgacaaaaataaggataaagaa
ctataagaccctgaatttagaaatttattagaattcttttacgtggcaataacagatgca
caattcaaaaagctcagagaggaatttcctgataatccattaagtgaaagtgcaattgtc
agtctgtttgaaaaatggtaggagattgtttttgaaaatactcaaggtgatccataaatc
attttggaagccccatcaaaaacatcaaatctattgactattcccaaaccataataaaca
attagtttagaattgactagggaagaagatgaaagatttaaagattttatgggagttgac
tttaagattccaggagtaaaggaattggctgatctttaaaaaagatgctaataaacataa
gagatatttacagatcctgatttccccccaaatgtaacaagtttgggaccaaaattcagt
gccaataattggaaacgtttataagaactcttttaaggagaacaaaaggttttttcaata
gatacccaacatgataaaagtggtgttggcttaaataaatggatatctcatagagatatt
tgccaaggtgatctaggtgattgctattttatgtcaactttgagttccatagcatgcaaa
tggcctgatcaaattaaagacctattccctatttagagagcaaacaaatttggtgtttat
ggtgttaagatgtgcattaatggagagtggaaagttatccctatagatgataatatacca
gtaaaaaatggcaaaattgcctttaccaaaaatgctgataaagagatttgggtgtcattg
ttagagaaatcatgggcaaaagtaaatgggtcctatactaatattgatgctggagatccc
agagaagttatcaaaacaattacaggaggtccagtttggcttttattaacaaacaagcca
aatttcaaagaaaatttcattacttgcgttaaacaaaagtgtgttatggtgactggtact
tatagtaaaaatgctgactactctgctattggattagaaccaggacatgcatactctatc
ttaaatgttaagactgtaaatcatccttaaagaggataagttcatttacttaagataaga
aatccatgggcacgtaaagaatggaagggtgattggagtgacgaatcagatttgtggacc
cctgaattaagagagtaggctggaaatactggaaaggaaaatgacggaatcttttttatg
tcattagatgattataccaaatacttcttttcagtgttctgtggatatttcaaaactgat
tacatttataactctatgagattcaacgttagaaggaacaagggagtgtatttcgaattc
gaaattaaaaaagaaggagaatacttctttgccattcattaagaatctacaagataatat
agatctcaacctgaattgaaatatgaatactcttatgttagactcttattagcaaaggaa
ttacaaaatggatatgaatacttagagggaaaattctataaggacattgaaacacatgtt
ggcagagtaggagagaatttcactcctggtaaatacattttatacatcaaaatcaaatgg
catgtaccatcttggaatgaacattcagttgtgttgagcacttatggagaacaatatgtg
taattgaaggaagttcccagggatccaaatcttgtttcttagacaatgatgcatcaagtc
agatccaacaataaggtggaagaagtattgccaggaatcactatgaagatggacaataat
ggaaatctaggaattggttacatctattataagaatgaatccaatcaataagtgaacttt
gaaacaaacttagtgaacaagggaggttgtaaattgaccaaaccggaaagaggttattat
ttcaagagttttatacctccataaggtgaaagattagttacttttacaatcacacctcca
ataacggagttgtccatgcctacattaagtcataaattattatga

DBGET integrated database retrieval system