KEGG   Paramecium tetraurelia: GSPATT00008123001Help
Entry
GSPATT00008123001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00511  Other glycan degradation
ptm00520  Amino sugar and nucleotide sugar metabolism
ptm00531  Glycosaminoglycan degradation
ptm00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ptm00604  Glycosphingolipid biosynthesis - ganglio series
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GSPATT00008123001
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    GSPATT00008123001
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    GSPATT00008123001
   00604 Glycosphingolipid biosynthesis - ganglio series
    GSPATT00008123001
   00511 Other glycan degradation
    GSPATT00008123001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GSPATT00008123001
Chaperones and folding catalysts [BR:ptm03110]
 Intramolecular chaperones
  Others
   GSPATT00008123001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 5024758
NCBI-ProteinID: XP_001438973
Genoscope: GSPATT00008123001
UniProt: A0CLA9
Position
undetermined
AA seq 544 aa AA seqDB search
MKFIIVIAILIVGTYQLMPMPKQFVKGSKSMKVINKCGIQFTNGNQYPEHVIELLRHYHS
LMTSKNECNFEQALNFNLKNQGALKFHISLQNDEQLYWVNKTQQEAYILKIDEYLNIQID
AHNHWGLARALDTVHQLTENDRIEFLPLIIEDEPAYSFRGVMVDTARHFLPLKTLERTID
ALAINKMNVMHWHITDDESFPLLLTNYSRITHTSKYSENEYYTKSDVSYLIEYASIRGVQ
IIPEIDSPAHVQSWGRNISDLEYIILNCGSTIKQYGQFDPTLDLTYDVVKSVFQDLSDMF
SKVQFIHFGGDEAIKSCYNQRPSIKEFMDKNGIADYIELQTYYRQRQKSIWKNEIKSKQR
IAYWYNKDDKLPAEDEDIIHWWGTTDELELVANRTNDFILSDYRPLYLDIGVGNAFGNTY
QTYQTWKDIYKWTPKAPEGFKGKIIGGEAPLWGETNNENTHFQRLFIRSSILGDTLWNPF
SKQSEKFYEFADRLGQMEDRMNKYGFPVSPFTHDYCKRHTKICFPILYEEEEPSIGQQHQ
FKEL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatcattgtaattgcaatcttaatcgttggtacttattagcttatgcctatg
cccaaatagtttgttaaagggtcaaagagcatgaaagttattaataaatgtggaatacaa
tttacaaacggtaatcaatatccagaacatgtaattgaattattgcgtcattatcattca
ttaatgacatcaaaaaatgaatgtaattttgaataggctttgaatttcaatctcaaaaat
taaggagctttgaaatttcatatttcccttcaaaatgatgaacaattatattgggttaat
aaaacttaataagaagcttatattttgaaaattgatgaatatttaaacatataaattgat
gctcataatcattggggtttggctcgagcattagacacagtgcattaattaactgaaaat
gatcgcattgaattcctaccacttataattgaagatgagccagcctattcttttagaggt
gtgatggtggatacagcaagacactttttgcctttaaagactcttgagaggactattgat
gcattggctatcaataaaatgaatgtaatgcattggcatatcactgatgatgaaagtttt
cctttacttctaacaaattatagtcgcataacccacacatctaaatattcagaaaatgaa
tactacacaaaatcagatgtatcctatttgatagagtatgcatccataagaggagtgtaa
ataatacctgaaattgattcaccagcccatgtgtaatcttggggaaggaatattagtgat
ttagaatatattattttaaattgtggaagcacaattaaataatatgggcaattcgatcct
actttagatttaacttatgatgtggttaaatcagtcttctaagatttatctgatatgttt
agcaaagtgcagtttattcattttggtggagatgaagctatcaagagttgctacaactaa
agaccatcaatcaaagagttcatggataaaaatggcattgcagattatatagaattgcag
acttattacagataacgataaaaaagtatatggaaaaatgaaattaaatctaaatagaga
atagcctattggtataataaggacgataaattacctgctgaagatgaagatatcattcat
tggtggggtactacagatgaactcgaattagtagcaaatagaactaatgatttcatactt
agtgactatcgtccattgtatttggacattggtgttggaaatgcttttggaaatacctat
caaacttactaaacttggaaagacatttacaaatggactccaaaagctccagaaggattc
aagggcaaaataattggaggtgaggcacctctttggggagaaaccaataatgaaaatact
cacttctaaagattgttcataagatcatccattttgggagatactttatggaatcctttc
tcaaagcaatcagaaaaattctatgaattcgctgatagactagggtaaatggaggataga
atgaacaaatatggatttccagtatcccctttcactcatgattattgcaagagacatacc
aaaatttgttttcctatcttgtatgaagaagaagaaccaagtatcggacaatagcattaa
tttaaagaattatga

DBGET integrated database retrieval system