KEGG   Paramecium tetraurelia: GSPATT00009157001Help
Entry
GSPATT00009157001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00640  Propanoate metabolism
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00009157001
   00640 Propanoate metabolism
    GSPATT00009157001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptm04147]
    GSPATT00009157001
Enzymes [BR:ptm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     GSPATT00009157001
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GSPATT00009157001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSPATT00009157001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 H_PPase DUF3303 Succ_CoA_lig DUF5078
Motif
Other DBs
NCBI-GeneID: 5025947
NCBI-ProteinID: XP_001440162
Genoscope: GSPATT00009157001
UniProt: A0CPP8
Position
undetermined
AA seq 429 aa AA seqDB search
MFRFHRIPKYLLSLHEYQTAEFFKSFQLPIPPGRICKTADEAYKAAARIIQEGSDKNSFT
DVVVKAQVHTGGRGKGYFKENGFNSGIHIASTPEDVREYASKMLGNTLITKQTGSLGKKC
EMVYVVERNFLRKELYLSILLDRNTGGLGIVASEKGGIHIEESDPNYIKKFSIEMPNAVE
EIDSSIYESVSKVYKLNPIQQKQMTEILKHMFDIFLQTDATLLEINPLGIDLQGNLIICD
QKLNIDDNSQFRQHAIFHMEDVRQKDWKEVEAQKHGLNYIALDGNIGCMVNGAGLAMATM
DLIKQYEGSPANFLDVGGKATDQEIVSALKIMDKDPNVEAILVNIFAGIARCDQIVLGLL
KGLTVLGMKKPMVLRMKGTKVEEAKKLIEESGFNMMFTEDLDEAAKKAVRMAAILRLAKE
ANINVNLTS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtttagattccatcgaattccaaaatatcttctgtctcttcatgagtattaaacagca
gaatttttcaaatccttccaattaccaatacctcctgggaggatctgtaagactgcagac
gaagcatacaaagcagcggctagaataatataggaaggatctgataagaattcattcaca
gatgtagttgtaaaggctcaagtgcatacaggaggtagaggcaagggatacttcaaggag
aatggatttaatagtggaatacatatagcatctactcctgaggacgtgagagaatacgca
tctaaaatgctaggaaatacattgattactaagtaaactgggagtttggggaagaaatgt
gagatggtttatgtagtagaacgtaactttttgaggaaggagctatatttatcaatacta
ctagaccgaaacacaggaggattgggtattgtggcatcggaaaaaggaggtattcatatt
gaggagagtgatccaaattacattaagaagttttcgatcgaaatgccaaatgcagttgaa
gagattgattcctctatttacgagagcgtttcgaaggtgtacaaattaaatccaatttaa
caaaagtaaatgactgaaattttgaaacacatgtttgatatctttttgtaaaccgatgca
actctattagaaattaatccacttggtattgatttacaaggcaatttgatcatatgtgat
cagaaattaaatatcgatgacaattcgtaatttagataacatgcaatattccatatggag
gatgtaagatagaaggattggaaagaagtagaagcttaaaaacatggacttaattatata
gccttagatggaaatatcggatgtatggtaaatggagcaggattagctatggctacaatg
gatttaatcaaacagtatgaaggatctcctgctaatttcttagatgtaggaggtaaagct
acagatcaggagattgtatctgccttaaagatcatggataaagatcccaatgttgaagcc
atcctagtgaatatctttgctggtattgcaaggtgtgatcaaatcgttttgggtttactt
aaaggattaactgtattgggaatgaaaaagccgatggtgttgagaatgaaaggaacaaag
gttgaagaggctaagaagttgattgaggagtctggatttaacatgatgtttacagaagat
ttagatgaagctgcaaagaaggctgttagaatggcagcaattctgagattggctaaagag
gccaatattaatgtgaacttaacgagttga

DBGET integrated database retrieval system