KEGG   Paramecium tetraurelia: GSPATT00011231001Help
Entry
GSPATT00011231001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K03113  translation initiation factor 1
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    GSPATT00011231001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ptm03012]
    GSPATT00011231001
Translation factors [BR:ptm03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    GSPATT00011231001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1 DUF3127
Motif
Other DBs
NCBI-GeneID: 5028781
NCBI-ProteinID: XP_001442996
Genoscope: GSPATT00011231001
UniProt: A0CXT2
Position
undetermined
AA seq 107 aa AA seqDB search
MTDNQFDNQNEFDEMVNFNFVIHIHLKKRSARKTQTIIVGIPDEFDLNKIIRFWKKQFNC
TGGIISKDEDYGDQVTIRLTGDNRQQIAKFLVEEGIALQDNIKVHGI
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaccaatttgacaattagaatgaatttgatgaaatggtaaacttcaacttt
gtcattcatattcatttaaaaaagagaagcgctagaaaaacacaaacgattattgttggt
attccagatgaatttgatttaaataagattattagattttggaagaaacaatttaactgt
actggtggtattatttcaaaagatgaagactatggagattaagtcacaattagattgaca
ggagataatagatagtaaattgccaaatttttagtggaagaaggaatagcgttataagat
aacattaaagtccatggtatttga

DBGET integrated database retrieval system