KEGG   Paramecium tetraurelia: GSPATT00012155001Help
Entry
GSPATT00012155001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03040  Spliceosome
ptm04141  Protein processing in endoplasmic reticulum
ptm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    GSPATT00012155001
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSPATT00012155001
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GSPATT00012155001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptm01009]
    GSPATT00012155001
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ptm03041]
    GSPATT00012155001
   03009 Ribosome biogenesis [BR:ptm03009]
    GSPATT00012155001
   03110 Chaperones and folding catalysts [BR:ptm03110]
    GSPATT00012155001
   04131 Membrane trafficking [BR:ptm04131]
    GSPATT00012155001
   03051 Proteasome [BR:ptm03051]
    GSPATT00012155001
   03029 Mitochondrial biogenesis [BR:ptm03029]
    GSPATT00012155001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptm04147]
    GSPATT00012155001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     GSPATT00012155001
Spliceosome [BR:ptm03041]
 Complex B
  Other components
   Prp19 complex
    GSPATT00012155001
 Complex C
   Prp19-CDC5 complex
    GSPATT00012155001
Ribosome biogenesis [BR:ptm03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    GSPATT00012155001
Chaperones and folding catalysts [BR:ptm03110]
 Heat shock proteins
  HSP70 / DNAK
   GSPATT00012155001
Membrane trafficking [BR:ptm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    GSPATT00012155001
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    GSPATT00012155001
Proteasome [BR:ptm03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    GSPATT00012155001
Mitochondrial biogenesis [BR:ptm03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    GSPATT00012155001
Exosome [BR:ptm04147]
 Exosomal proteins
  Proteins found in most exosomes
   GSPATT00012155001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FGGY_C StbA
Motif
Other DBs
NCBI-GeneID: 5029784
NCBI-ProteinID: XP_001444000
Genoscope: GSPATT00012155001
UniProt: Q3SD87
Position
undetermined
AA seq 659 aa AA seqDB search
MAQTPAIGIDLGTTYSCVGIWVNDKVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVA
RNPQNTVFDAKRLIGRKFAESTVQKDIKLWPFKVEAGADDKPMIVVKYKGENKKFHPEEI
SSMVLTKMKETAEAYLSKQVSKAVVTVPAYFNDSQRQATKDAGAIAGMNVLRIINEPTAA
AIAYGLDKKAKHEEHVLIFDLGGGTFDVSLLAIEDGVFEVKATAGDTHLGGEDFDNKLVE
YCCAEFLKKKGIDIRGNPRSLRRLRTQCERAKRVLSSANQTTIEVDALDANEDFNCTITR
AKFEELCMSMFKECIPPVEKVLKDSGISKNQIHEVVLVGGSTRIPKVQELLRDYFNGKEL
NKSINPDEAVAYGAAVQAAILTGQGNEQVKDLLLLDVTPLSLGIETAGGVMTVLIPRNTT
IPTKKSQTFTTYADNQPGVLIQVYEGERQMTKDCHKLGQFNLDGIAPSPRGVPQIEVSFD
LDENGIMNIHAEDKATKKSNKITITNDKGRLSKDDIEKLVKEAEKFKAEDDIIKSKIEAK
NSLEQTTYQIRNTIKDEKVKDKFSAEEKTKLESLVDETTKWIDANPNAETNDYKNKLKAL
EEVFHPIMQRVYQATGGAPPGAEGAGFPGGAGFPGGAGFPGGAGFPGGPAGGPTVDQVD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcttaaacacctgctattggtattgatttaggaacaacctactcttgtgttggtatt
tgggtaaatgataaagttgaaatcatcccaaatgattaaggtaacagaacaactccatca
tatgttgcattcactgatacagaaagacttattggtgatgctgctaaaaactaagttgct
agaaatccataaaacacagtttttgatgcaaaaagattaatcggaagaaaattcgctgaa
tccacagtttaaaaggatattaaattgtggccattcaaggttgaggctggtgctgatgac
aagccaatgattgttgttaaatataagggagaaaacaaaaaattccatccagaagaaatt
tcatcaatggtcttaaccaaaatgaaggagactgctgaagcttatttgagcaaataagtc
tcaaaggctgtcgttacagtcccagcttatttcaatgactcttaaagataagccaccaaa
gatgctggtgccattgctggtatgaatgttttgagaattatcaatgaaccaaccgctgct
gccattgcttatggtttggacaagaaagcaaaacacgaagaacacgttctcatcttcgat
ttgggaggtggtacattcgatgtctccttattggctattgaagatggtgtctttgaagtc
aaggccactgctggtgatactcacttgggaggtgaagatttcgataacaaactcgtcgaa
tattgctgtgctgaattcttgaagaagaaaggtattgacatcagaggaaacccaagatca
ttgagaagactcagaactcaatgtgaaagagcaaagagagttctctcatctgccaatcaa
accacaatcgaagttgatgctttggatgctaatgaagatttcaattgcacaatcacaaga
gccaaattcgaagaattatgcatgagcatgttcaaggaatgcatcccacctgttgaaaag
gttcttaaagattctggtatttccaagaatcaaatccacgaagtcgtcttggtcggagga
tcaaccagaattccaaaagtctaagaattattgagagactacttcaatggaaaggaattg
aacaaatcaatcaatccagatgaagctgttgcttatggtgctgcagtctaagctgccatc
ttgactggataaggtaacgaataagtcaaggatctcttgttgttggatgtcaccccattg
tccttaggtattgagactgctggtggtgtcatgactgttttgatcccaagaaacacaacc
atcccaacaaagaaatcataaactttcacaacctatgctgataatcaaccaggagtcttg
atccaagtctatgaaggtgaaagataaatgaccaaggattgccacaaattgggacaattc
aacttagatggtattgccccatcaccaagaggagttccataaattgaagtctcattcgat
cttgatgaaaatggtatcatgaacatccacgctgaagacaaagccaccaagaaatcaaac
aagatcaccatcacaaacgacaagggtagattatcaaaggatgacattgaaaaattagtt
aaggaagctgaaaaattcaaggctgaagatgacatcatcaaatccaagattgaagccaag
aacagtcttgaataaaccacctattaaatcagaaacaccatcaaggatgagaaagtgaaa
gacaaattctcagctgaagaaaaaactaaacttgaatcattggttgatgaaacaactaaa
tggattgatgctaacccaaatgctgaaaccaacgactacaaaaacaaattaaaggctctt
gaagaagtcttccatccaatcatgcaaagagtttatcaagccactggaggtgccccccca
ggagctgaaggtgctggattcccaggaggtgcaggattcccaggaggtgctggattccca
ggaggagctggattcccaggaggtcctgctggtggaccaacagtcgattaagttgattga

DBGET integrated database retrieval system