KEGG   Paramecium tetraurelia: GSPATT00012263001Help
Entry
GSPATT00012263001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00564  Glycerophospholipid metabolism
ptm01100  Metabolic pathways
Module
ptm_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GSPATT00012263001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     GSPATT00012263001
    2.7.1.82  ethanolamine kinase
     GSPATT00012263001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 5029892
NCBI-ProteinID: XP_001444108
Genoscope: GSPATT00012263001
UniProt: A0D0Z4
Position
undetermined
AA seq 340 aa AA seqDB search
MNNIDQFFISHIQKFVPSWSHLQCDDLRITKTIGITNKTYIIEADATPSKIIFRHFGEVG
VGLFLNREQELHIARQVAKCKMGPHFYGHTSHVRLEEYIENEVMSQESMKDPDTYTLVAQ
TLCKFHQIDVSSQMNDRTPLFEKHLQENSDFLSQVREKVCSSLFSEDERSILSNMAHWFS
EEEVKFLQSVLPKDDIVFSHNDLLANNILLIPPNFDKVVFIDFEYSSYNFRGFDIANYFN
ESQFSYLNPNPPYFYIEEGMIDEEILKDFVKVYIEKSGLDLDYQTLLHQVYIGQLFSHFF
WAAWGIIMAKSNDIVFDYLAFVEVRYHKYYQLKKHLFGKK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatatcgattaattcttcatttctcatatataaaagtttgttccatcttggagc
catctttaatgtgacgacttgagaattacgaagactataggaataacaaataagacatat
attattgaagcagatgctactccaagcaaaataatctttcgtcattttggtgaggtcgga
gttggattatttttgaatagagaataagaattacacattgcaagataagttgctaaatgt
aaaatggggccacatttttatggtcacacttcacatgttcgtttggaagaatatatagaa
aatgaggtcatgagtcaggaatcaatgaaagaccccgacacctacactttggtggcttag
accttgtgcaagtttcatcagatcgatgtatctagtcaaatgaatgacagaacaccgttg
tttgaaaagcacttgcaagaaaattcagacttcttatcgtaagtaagggagaaagtttgt
tcgagtctcttctctgaagatgaaagatccattctatctaacatggcccattggttctca
gaggaggaagtcaagtttttatagtcagttttaccaaaagatgatattgtattttcccat
aacgatctattggcgaacaacatcttattgattccacctaacttcgataaggttgtgttc
atcgattttgagtattcttcctataatttcagaggatttgacatagctaactatttcaat
gaatcacaatttagttatctaaacccaaatccaccttacttttatatagaagaaggaatg
attgacgaggagatcttgaaggactttgtcaaagtctatatcgaaaagtcaggattggac
ttagactatcaaactttactacaccaagtctacattggatagctattctcacacttcttt
tgggcagcatggggaatcattatggcaaaatcaaatgatattgtatttgattatcttgct
tttgtagaagttagatatcacaaatattactaactaaagaagcatctttttggaaaaaaa
tga

DBGET integrated database retrieval system