KEGG   Paramecium tetraurelia: GSPATT00012934001Help
Entry
GSPATT00012934001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00071  Fatty acid degradation
ptm00410  beta-Alanine metabolism
ptm00592  alpha-Linolenic acid metabolism
ptm00640  Propanoate metabolism
ptm01040  Biosynthesis of unsaturated fatty acids
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01200  Carbon metabolism
ptm01212  Fatty acid metabolism
ptm04146  Peroxisome
Module
ptm_M00087  beta-Oxidation
ptm_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GSPATT00012934001
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GSPATT00012934001
   00592 alpha-Linolenic acid metabolism
    GSPATT00012934001
   01040 Biosynthesis of unsaturated fatty acids
    GSPATT00012934001
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSPATT00012934001
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    GSPATT00012934001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     GSPATT00012934001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_ox_N Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 5030631
NCBI-ProteinID: XP_001444846
Genoscope: GSPATT00012934001
UniProt: A0D332
Position
undetermined
AA seq 217 aa AA seqDB search
MSALEIARKKISFDVNKLSHFIWEGEERFKRFMAFQKLCSSDPLLRNNPKDIGIGRAETY
ELYARKMKKLLEVADLRDIKEFATLIYPEALVSSLNYEMFMPTIMNLGTEEQVKLFYEPA
SRWEILGCYSQTELAHGSDINRIETTATYDKQTKSFIINTPSLKATKWWGSDMGITATHV
VTQAQLYIDGKRCGVQNFVVQIRDVKTHLNTSRHFGR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacttgagatagcacgcaagaaaatatcatttgatgtaaataagctgtcccac
ttcatttgggaaggagaggagagattcaagagattcatggcattttagaagctatgcagt
tctgatcctcttcttcgtaataatcctaaggacattggaataggaagagccgaaacatat
gaactatatgcaaggaaaatgaagaagttgttggaggtggctgacttgcgtgatatcaaa
gaattcgcaaccttgatctatccagaggctttggtgtcatcattgaattatgaaatgttc
atgcccacaataatgaatttgggaacagaagaataagtgaagctgttttatgagccagca
tcaagatgggagatcttgggttgttattcatagacagaattagcacatggttcagatata
aatagaatcgaaacaacagccacatatgataaataaacaaaatctttcataattaacact
ccctcattgaaagccacaaaatggtggggaagtgacatgggcataacagctactcatgtc
gtaacctaagcctaattgtatatagacggtaagagatgcggagtatagaattttgttgtc
taaatcagagatgtgaaaacccatctaaacacttccaggcattttggtcggtga

DBGET integrated database retrieval system