KEGG   Paramecium tetraurelia: GSPATT00014029001Help
Entry
GSPATT00014029001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
ptm  Paramecium tetraurelia
Brite
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    GSPATT00014029001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00014029001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1719 DUF1639
Motif
Other DBs
NCBI-GeneID: 5032244
NCBI-ProteinID: XP_001446459
Genoscope: GSPATT00014029001
UniProt: A0D7P5
Position
undetermined
AA seq 125 aa AA seqDB search
MAPSKSPKAEAAKKTVKTVKTKKGSDDKKKARRRQETFALYIYKVLRQVHPEIGVSRKAM
NIMNSFINDIFDRIALEASKLVRFNKRRTLSSREIQTAVKLLLPGELARHAISEGTKAVT
KYTSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcaccatcaaaatcaccaaaggcagaagccgcaaaaaagacagtcaagacagtcaag
accaagaagggctcagatgacaagaagaaagcaagaagacgataagagacattcgctctc
tacatttacaaagtcttgagataagtccacccagaaattggtgtttcaagaaaagctatg
aacattatgaactcattcatcaatgatatcttcgatagaattgcccttgaagccagcaaa
ttggttagattcaacaagagaagaaccctcagctcaagggaaatccaaaccgcagtcaag
ttgctcctcccaggagaattggccagacatgccatctctgaaggaacaaaagccgtcacc
aaatacacaagtggttga

DBGET integrated database retrieval system