KEGG   Paramecium tetraurelia: GSPATT00015130001Help
Entry
GSPATT00015130001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K16794  platelet-activating factor acetylhydrolase IB subunit alpha
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00565  Ether lipid metabolism
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    GSPATT00015130001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptm03036]
    GSPATT00015130001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptm04147]
    GSPATT00015130001
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    GSPATT00015130001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00015130001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 LisH DUF4988 MbeD_MobD
Motif
Other DBs
NCBI-GeneID: 5033432
NCBI-ProteinID: XP_001447633
Genoscope: GSPATT00015130001
UniProt: A0DB19
Position
undetermined
AA seq 403 aa AA seqDB search
MVLTARQRDELNQAIHQYLLISYQQSAQLFKTEAAVKDGQIEADLLEKKWNSIVRLSKRV
ITLEQQVEQLNEQLAQAQAGKIQFNKSDDEQRLTPIEKFKLEGHRAGVNCVAFHPQYQIL
GSASDDGSIKLWDYESGHFEKTLKGHTSNVNCLAFDPTGKYICSASSDLSIKIWELKNHT
CVKTLIGHEHSVSTVQFSDHGDFILSASRDKNIKLWEVATGFCKKTFSEHQEWVRCAVFS
NDEKQIASCSQDQMIYIWVIDSGQVLHQLSGHEHVVEQVKYIPEHGAKQILTQQQQQNIQ
TINLLVSVSRDKEIKIWNTILGTNLFTLSGHDNWVNGVSFHPDGVHMLSVSDDKTIRVWN
LKEQKQKKKIENAHDKFILKCEINKFIFATCSVDQTIKLWLLS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgactgctagacaaagggatgaattaaattaggcaatacatcaatatttattg
ataagctatcaatagagtgcacaattgtttaaaactgaagctgctgttaaggatggataa
atcgaagctgatttattggaaaaaaaatggaattctattgtaaggttgtcaaaaagagta
ataactttggaatagcaagtagaacaattgaatgaataattagcataagcttaagctggc
aaaatacaatttaataaatctgatgatgaataaagattaacaccgattgagaaatttaaa
ttagaaggacatagagcaggagtgaattgtgtggcttttcatccttaatactaaattctt
ggttcagcaagcgatgatggcagtattaaattatgggattacgaaagtggtcatttcgaa
aaaaccttaaaaggacatacaagtaatgtaaattgtttggcatttgatcctactggaaag
tacatttgtagtgctagtagtgatttatcaataaaaatatgggaattgaaaaatcatacg
tgtgtaaaaacactcataggtcacgaacatagtgtatcaacagtgtaattttctgaccat
ggagacttcatattgagcgccagcagagataaaaatatcaaattatgggaagtggcaaca
ggattttgcaagaaaacattctctgaacattaagaatgggtcagatgtgctgtatttagc
aatgatgaaaaacaaatagcctcctgttcttaagattaaatgatttatatttgggtgata
gatagtggataagttttacattaattgagtggacatgaacatgtagttgaataagtcaag
tatatcccagaacatggggctaagcaaatacttactcaacaataacagcaaaatatttaa
acgattaacttattagtttcagtgtcaagagacaaggaaattaaaatttggaatactatt
ttaggaacgaatctgtttacattatctggccatgataattgggtcaatggagtctctttt
catccagatggagttcatatgctttcagtatctgatgacaagactattagagtttggaac
ttgaaagaatagaaacaaaaaaagaaaatagaaaatgctcatgacaaattcatattaaaa
tgtgaaataaataaatttatattcgccacatgttcagtagaccaaacaattaaattatgg
ctattaagttga

DBGET integrated database retrieval system