KEGG   Paramecium tetraurelia: GSPATT00015873001Help
Entry
GSPATT00015873001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00010  Glycolysis / Gluconeogenesis
ptm00020  Citrate cycle (TCA cycle)
ptm00620  Pyruvate metabolism
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00015873001
   00020 Citrate cycle (TCA cycle)
    GSPATT00015873001
   00620 Pyruvate metabolism
    GSPATT00015873001
Enzymes [BR:ptm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     GSPATT00015873001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_16
Motif
Other DBs
NCBI-GeneID: 5034196
NCBI-ProteinID: XP_001448411
Genoscope: GSPATT00015873001
UniProt: A0DD97
Position
undetermined
AA seq 552 aa AA seqDB search
MLHHLWRYTYNTSKALSLEQLTRWGLHNTSVVRNASTPELYEIAAMDPLSPDPETRPGSI
SSTGAMVAYSGRRTGRSPKDKRIVFDEQTEHEIWWGSVNIPIPKKSHNLLEQVALQFLNT
RPRLFVVDGYAGWDPHSRLRIRVFCTRAYHALFMQNMLIRPTNEELKKDFSDDVDFHIFN
AGPMCAPKLVEGVGSETCVSVNLTDKKMVILGTQYAGEMKKGVFGVTHYMFPKQGILTLH
SSANEGVNGDVTLLFGLSGTGKTTLSADPKRKLIGDDEHAWSENGIFNIEGGCYAKCVDL
SKEKEPEIFNAIKFGSVLENIEFMSKDSREVDYHNISITENTRVSYPLDFIPGAKNPAVG
GHPKNILFLTCDAYGVLPPVSLLSPEQAMYHFISGYTAKVAGTEMGVKEPVATFSACFGE
AFLPLHPTLYATMLAEKMKQHGTKCWLVNTGWSGGKYGIGKRMSLKYTRSIIDAIHTGEL
VNGEFEKFDIFNLQIPKRATGVPDSILHPKNTWINKSEFERTLRNLADKFQKNFQKYADK
ATSEVINAGPQI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatcacttgtggagatacacatataatactagcaaagccctttctttggaatag
ttgacaagatggggattacataatacctcagttgttagaaatgccagtactccagaattg
tacgaaattgcagctatggatccattgtcaccagatccagagacacgaccaggctctatt
tcaagtacaggagcaatggtagcctattcaggaagaagaacaggtcgatctcccaaagac
aagagaattgtgtttgatgaataaactgagcatgaaatatggtggggaagtgtcaatatt
ccaattcccaagaaatcacacaatcttttggaacaagttgccctttaatttttgaataca
agaccaagattatttgttgttgatggatatgcaggatgggatcctcatagtagacttaga
attagagtgttttgcacaagagcatatcatgctttatttatgtaaaacatgcttatcaga
ccaacaaacgaggaattaaagaaagatttcagtgatgatgttgattttcatattttcaat
gcaggaccaatgtgtgcaccaaaattggtggaaggagttggctcagaaacatgtgtttct
gtcaatctcaccgataaaaagatggtcatcttaggaactcaatatgcaggtgaaatgaaa
aagggagttttcggagttacacactatatgttccctaaacaaggaatccttacactccat
agttcagcaaatgagggagtcaatggagatgttaccttactctttggtttgagtggaact
ggtaaaaccactttgagtgcagatcccaagagaaaattaataggagatgatgaacatgca
tggtctgaaaatggtatctttaacattgaaggtggttgctatgctaaatgtgtagatcta
agcaaagaaaaggagccagaaatttttaatgctatcaaatttggatccgtcttggaaaat
attgaattcatgtctaaagattccagagaagtagactatcataacatatccattacagaa
aatacaagagtcagttatcctttggatttcattccaggagcaaagaatccagctgttgga
ggacatcctaaaaacatcttattcctcacatgtgatgcttatggtgtattaccccctgtt
tccttattatcaccagaataagctatgtatcatttcatttcaggatacacagccaaagtt
gctggtacagaaatgggagtcaaagaaccagttgctactttttcagcctgctttggagaa
gcattcttaccattacatccaactctctatgctactatgttagctgaaaaaatgaaataa
catggtaccaagtgctggttagttaacactggttggtctggtggcaaatatggtattgga
aaaagaatgtctctcaaatacacaagatccattatcgatgctattcatactggcgaattg
gttaatggagaatttgaaaaatttgacatcttcaacttataaatcccaaagagagccaca
ggtgttcctgatagcatcctccatcctaaaaatacttggatcaacaagagtgaatttgaa
agaactttaagaaatttagctgataaattctaaaagaacttctaaaaatatgctgataaa
gctacctcagaagtcattaatgcaggaccataaatctga

DBGET integrated database retrieval system