KEGG   Paramecium tetraurelia: GSPATT00017766001Help
Entry
GSPATT00017766001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00017766001
   01009 Protein phosphatases and associated proteins [BR:ptm01009]
    GSPATT00017766001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSPATT00017766001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: Other
  Wnk family
   GSPATT00017766001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSPATT00017766001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 5036619
NCBI-ProteinID: XP_001450834
Genoscope: GSPATT00017766001
UniProt: A0DK70
Position
undetermined
AA seq 569 aa AA seqDB search
MKDDQIKMRNMILIKDLINSDLQIFEVIQLLLGMKSGEIIQNMNDDTSLSSEDDEQTSKI
IENDPTGRFSKYNEEIGKGAYKSVYRGYDNESGCEVAWNVVILQFILHLDEIRRARQEIT
ILKTLKHKNIINFIHSWQSRSKRQIVFITEIVNGGSLKNYLRRITRPKLKVIKYWCRQIL
EGLEYMHQQNIIHRDLKCENILIDTNNNELKIGDLGLSIQMQSNNTNSVLGTPEFMAPEI
YHGNYDTKVDIYAFGMCILEIVTGMKPFCECKGGTGQVIKKVMESQKPQSLEGILNEKIK
SIILECLKPANERPTATQLLNQYFQSSHIDEDNSPVQLNESLLNQISHDSKNSSFFKNNL
SKNISEVKGTTNNHINNNFTNQPNKLILFQECNPNSMKQSDVRHCEQQNKLSMDTADDFS
IEQQFGKQYKEYYITQNDETLLDLEQRQERELQLLLTLHKQQKADLSNKLQQTNRSIIPY
GSGFLSPKSFSTLFEFNNDQHQQLQGNQQQSQILKVFPVSESTNSEEIGRKPNNKEDDLN
MIQSKQPCKLSTDVVVQSKVQNVRTPIQG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgaccaaattaaaatgcgcaatatgattcttataaaagatttgattaattca
gatttacaaatatttgaggtaatttaattattgcttggaatgaagtctggtgaaataatt
caaaacatgaatgacgacacgtctctatcatctgaggatgacgaacagacttccaagatt
atagaaaatgatccaacaggtcgttttagtaagtacaatgaagaaattggaaaaggagcc
tataagagtgtttacagaggatatgataacgagagtggatgcgaagtagcatggaatgta
gtaattttataattcattttacatttagacgaaataagaagagccagataagagataaca
atattgaaaacattgaaacacaagaacatcattaattttatacattcatggtagagcaga
tcgaagaggcaaatcgttttcatcaccgaaattgttaatggaggatcgttgaaaaattac
cttaggagaatcacaagacctaagctaaaagtcattaaatattggtgcagacagatcttg
gaaggattggaatacatgcattaacaaaacattatccacagagatttgaaatgcgaaaat
atcttgattgacacaaacaacaacgaattaaaaataggggatcttggcctatcgatttaa
atgcaatccaataatacaaattcagtactgggaacaccagaatttatggcacctgaaata
tatcacggaaattatgacactaaggttgatatctatgctttcgggatgtgcattctggaa
atagtgactggcatgaaacctttttgtgagtgcaaaggcgggactggttaggtcatcaaa
aaggttatggaatctcaaaagccttagagtttagaaggaatcttaaatgaaaagattaaa
tccatcattttagagtgtctcaaacctgcaaatgagagacctactgctacttaactgttg
aaccaatatttttaatcctcccacattgatgaagacaattctcctgtttaattaaatgag
tcacttctgaactagatctcacatgacagcaaaaactcctccttcttcaagaataactta
tctaaaaacatcagtgaagtcaagggaactactaacaatcacattaataataattttact
aattaacccaataaactaattctctttcaggaatgcaatcctaattcaatgaaacaatct
gatgtaagacattgtgaataataaaataagttaagcatggatactgctgatgatttctca
attgagtaataattcggcaaacaatacaaagaatattatatcactcaaaatgacgaaacc
ctgttggacttagaataaagacaagagagagaattacaactattattaacattacataaa
cagcaaaaggctgatctctcgaataagcttcaataaacaaatagatctattataccatat
ggatcagggtttttatcaccaaaatcattctccaccttatttgaattcaacaatgactaa
catcaacaattataaggaaactaatagtaatctcaaatcttgaaagtctttcctgtaagt
gaaagtacaaattcagaagaaattggaagaaagccaaacaacaaagaagatgatttgaac
atgatttaatcaaaacaaccatgtaaattatctacagatgttgttgtgtaatcaaaagtt
taaaatgtcagaactcctatttaaggttga

DBGET integrated database retrieval system