KEGG   Paramecium tetraurelia: GSPATT00017952001Help
Entry
GSPATT00017952001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00017952001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GSPATT00017952001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: Other
  CAMKK family
   GSPATT00017952001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like RIO1 APH
Motif
Other DBs
NCBI-GeneID: 5036804
NCBI-ProteinID: XP_001451019
Genoscope: GSPATT00017952001
UniProt: A0DKQ5
Position
undetermined
AA seq 427 aa AA seqDB search
MGSVCAKKKEARINQVIHDQSASPYMPDQQTSLLLRDKKTQPQTLVQVKIPKKNKKVRET
VKAVTLKNNEGQKMLNDYVFDEFLGQGAFGKVKLAHKQGDPSKRYAIKILKKSKLKRQRE
FVKDANGNLVVKDALQDVRKEIAIMKKIRHKNLIQLYEVIDNPTCDKLFMVLEFAEGGQL
IEWDEDEGKFYKLNEDEELTEDVLSSLFRDCIKGLAFLHKNKIVHRDLKPQNVLMSGKTA
KIADFGVSQVVGSKNDVLENTQGTYYFMPPEACDKETAKDGYSGRAADIWALGITFFAFT
YLNVPFTGNNIPDILKNISQNEVVFPEDSAISDGLKEFLRFILNKDPKQRPTVNEIAKHP
WVNQSSANLLDEMVQEEKVMEVSQVDIDNAFSLVSLMKIKSWAQKWRTESNLKKSGPQNG
VDEIEIK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggatcagtttgtgcaaagaaaaaagaagcaagaattaattaagtcatccatgaccaa
tctgcctcgccctatatgcctgatcaacaaacttctttgttactcagagacaaaaagaca
cagcctcaaactttagtttaggtcaagatccctaagaaaaacaaaaaagtcagagaaact
gtcaaggcagtcacactgaaaaacaatgaaggacaaaagatgttgaatgattacgttttc
gatgaatttttgggtcaaggtgctttcggcaaagtcaaactggcacacaagtaaggagat
ccctccaaaagatatgctatcaaaatacttaaaaagagcaagctaaaacgacaaagggaa
tttgttaaggatgctaatggaaatctcgtcgttaaagatgctttgcaagacgtcagaaaa
gaaattgctatcatgaagaaaatcagacacaagaacctcatttaactttatgaagttatt
gacaatccgacttgtgacaaactgttcatggttcttgaattcgcagaaggaggtcaactg
attgaatgggatgaggatgagggcaaattttataaattgaatgaagatgaagaattaaca
gaagacgtactttcttcactttttcgagattgcattaaaggcttagcattcctccataaa
aataaaatagtacacagagatctcaaacctcaaaatgttttgatgtcaggcaaaactgcc
aaaattgctgatttcggagtctcataagttgtgggttccaaaaatgatgtactcgagaat
acacaaggaacttattatttcatgcctcctgaagcctgcgataaagaaacagccaaagat
ggatattctggcagggctgccgatatttgggcacttggtatcaccttcttcgctttcacc
tacttaaatgtcccatttactggaaacaacattcctgacatactcaagaacatatcataa
aatgaagtggtttttcctgaagattctgccatcagtgatggacttaaagaatttcttaga
ttcatattgaataaagatccaaaataaagaccaaccgtcaatgaaattgccaagcatcct
tgggttaattaaagttctgccaacctattagatgaaatggttcaagaagaaaaggtcatg
gaagtctcataagttgacatagataatgcattttccttagtttcattgatgaaaattaaa
agttgggcttaaaaatggagaactgaatctaatctaaaaaaatctggaccataaaatggt
gttgatgaaatagagattaaatga

DBGET integrated database retrieval system