KEGG   Paramecium tetraurelia: GSPATT00018933001Help
Entry
GSPATT00018933001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 5037919
NCBI-ProteinID: XP_001452134
Genoscope: GSPATT00018933001
UniProt: A0DNX0
Position
undetermined
AA seq 160 aa AA seqDB search
MSWRKPKVIHQESGCGYEIRGFTEPTFKRVPHCHNDDDIDVDIPNGDLEFGRKMYGQACA
GCHDLDSDLDQGPALRNAFLRRLGSNKKFSNYGWDLRARRLYWTRKLLWDFLQNPEKMFL
DTNMQFDGIQDPRTLGSIIDYMQYLTVYTHDHRGSKRPIF
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaggaaaccgaaagtaattcattaagaaagtggatgtgggtatgaaataaga
ggattcactgaaccaacattcaaaagagttcctcattgtcacaatgatgatgacattgat
gtagacattccaaatggggaccttgaatttggtaggaaaatgtatggataagcatgtgct
ggttgtcatgatttagacagcgatcttgattaaggaccagctttgagaaatgccttttta
agaagactaggatcaaataagaaattttctaattatggatgggatttaagagcaagaaga
ttgtattggactaggaagctattgtgggatttcttgtaaaatcctgagaaaatgttttta
gatactaacatgcaattcgatggaattcaagaccctagaactttaggtagcataattgac
tacatgcaatatttaacagtgtatactcatgatcaccgaggatcaaaaagacccatcttt
tga

DBGET integrated database retrieval system