KEGG   Paramecium tetraurelia: GSPATT00020342001Help
Entry
GSPATT00020342001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 5039852
NCBI-ProteinID: XP_001454067
Genoscope: GSPATT00020342001
UniProt: A0DUF3
Position
undetermined
AA seq 236 aa AA seqDB search
MSEDPNEKWKKILLNPYGKSKDDVQNEIRAMHKEQQMIDEAITREALLQTIKAKKTYRNL
TNPNTNADKSKQVPVDGDLKKGAQVFMRACASCHSLEIFTGKPYAADFSFQESSGPSLAQ
IYNKPAASQRVYEEYTMALLDSKIFWNSYNLFMWAKDPQAMCKGTKCLQRGELLESAEER
ADLVKFLKGFAKATSDLYRRSFTKYHGYEWQNYREQGLAKAREVAHQRQGYEPEKK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagatccaaatgagaaatggaagaaaattcttttgaatccttatggtaaaagc
aaggatgatgttcagaatgagattagagcgatgcataaagaatagcaaatgattgacgaa
gcaataaccagagaggctctgttataaacaataaaggcaaagaagacatatcgaaattta
acaaatcccaatactaacgctgataaatctaaataagtgccagtggatggtgatttgaaa
aaaggagcacaagtatttatgcgtgcatgtgcttcttgccactctttggagatattcaca
ggaaaaccatatgcagcagatttttcattttaagaatccagcggtccatctttggctcaa
atatataataagccagcggctagttagagagtatatgaagaatacacaatggccttattg
gattctaaaatattttggaatagctataatctatttatgtgggctaaagatccataagca
atgtgtaaagggacaaaatgtttgtaaagaggagaactattggagagtgcagaggaaaga
gctgacttagtaaagtttttgaaagggtttgcaaaggccacttcagatttgtatagaaga
tcattcacaaagtatcatggatacgaatggtagaattatagagaatagggactggctaaa
gcaagagaggttgctcattagagataaggatatgaaccagagaagaagtga

DBGET integrated database retrieval system