KEGG   Paramecium tetraurelia: GSPATT00021367001Help
Entry
GSPATT00021367001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptm01002]
    GSPATT00021367001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     GSPATT00021367001
Peptidases and inhibitors [BR:ptm01002]
 Metallo peptidases
  Family M16: pitrilysin family
   GSPATT00021367001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_M Peptidase_M16_C ApoC-I
Motif
Other DBs
NCBI-GeneID: 5040916
NCBI-ProteinID: XP_001455131
Genoscope: GSPATT00021367001
UniProt: A0DXG7
Position
undetermined
AA seq 1157 aa AA seqDB search
MKKEQHQQRRDTTLIQLLVLLGACFTMGIVLFKVVGLHGAQNDLSFEQASLIQEQTYLEQ
QIKALQNSLAQPSFLEVRMSVNKKQHKSKIHSSEHKPLEIQKPTVDKKEYEYLELPNKLK
VLLIRDPETKLTQAALNVNVGSWYEPDEFPGLAHFLEHMLFQGSHTYPETSYFEQLVAKG
GGYTNAYTEGTRTNYYFTIDTSRTSEALNVFAHFFIDPLLSQEMVQKEANAVNSEYEINV
AGDGWKILHLMSLMSDPKHPMSRFTIGNLQSLLKPHVVEALKKFHEQYYSSNQMALVIKS
SQPIEMMKEFIESSEFLKIPNLEIEKPSLAHFGLPIKDVSKLVKYHINTRATTLIYFYQL
EDSTKYFETKPLQFINSIVRSRHDGGLYNYLVSKNLIVDMDSQPFLGNNGCFQFYLIEVE
LSETLIGQQKDYALQIGQAIISYFEEQIHKFYDEEQNPTDFLEETYKTKKAMSDVQFKFL
EKDIDIFKLSHNLNTFPPKYVLNAETSYFKYDPQCIYNYLADLMNPNNMLILIGDDGYKL
VQEEIENEELKASFLSFQQPSTLLLQQSVAVSDLDFINQRELQFSNDLYHIQYDVKPLER
DSLDFMMLDNIPLSLPQINHYVPVNLAFKSLCESQQISYIQSVDSDTLYDRKNRQNIFIE
NTHKMPFYFTSKKECQEHEFEYEQYNHFPQLIKKDIEGKTWWRLDRSYSPTVYAGMNFET
ALDMKSLKKVALLTVFNSYVSDNLYKSLQQSFEAGYELSFDSSMKGLSLEMYGWSDKFEY
FYKNVLREIKNEISDDDLLNRVKLSQITELSNTFEQKLFVQATSVILPTIIQGQPTPSQM
IDEINSVTKEELSQFQKEMLENFRFTTYFTGNILRDEVQSLQNQIPKIFDESTSHIRIQN
HITQVSDLTRKSIVYSLVSKSTNQLDTNGVTLNYYQIGYRDQKQLAMMNLLYKILHNAAY
AYLRTQLQLGYVVSVKFKPVGCLDSAQILVQGTAKPPYVVNQHIEEFLINYGRELKEMTD
QQFEELKTTTISGLKEVEKNLKDKARSTWSHIKNNDLAFEEKEIAAQYINMVTKSDLFSF
YDKVFTSGKLSLQVYGQGMITQTMGISVNDLANKVKSNSLSKEQTYAVRDEVTVSTSDDF
KQRITSNYNCNYKISNI
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagtagcatcaataaaggagagacacaacactgatacaattgttagtattg
ttgggcgcatgctttacaatgggcatagttttattcaaagttgtgggattacacggagct
tagaatgatttatcatttgagtaggcctcgttgatttaggaataaacatacttagagcaa
taaataaaagcattacaaaattcattggcttaacccagctttttagaagtcagaatgagt
gtgaataaaaaatagcataaatcaaaaatacattcatccgaacataaacctcttgagata
tagaagccaacagtagacaaaaaggaatatgaatacttggaattacctaataaattgaaa
gtcttgttaatacgagatccagaaaccaagttaacataagcagcattgaatgttaatgta
gggtcatggtatgaaccagatgaatttcctggtttagctcattttttagagcacatgcta
ttttaaggttcacatacctatcctgaaacaagttattttgaataattggtggctaaagga
ggaggttacactaatgcatacactgaaggaaccagaaccaattactattttacaatagat
acaagcagaacaagtgaggctttgaatgtatttgcacacttttttatagaccctctctta
tcataagagatggtctaaaaggaagctaatgcagtgaattctgaatatgagataaatgta
gcaggagatggatggaaaatattgcatttaatgagtttgatgtcagatcctaagcatcct
atgagtagattcactattggaaatttatagtcattacttaagccgcatgttgttgaagcc
ttaaaaaagtttcatgaataatattattcatctaatcaaatggctttggtgatcaagagt
tcataaccaattgaaatgatgaaagagttcattgaatcaagtgagttcttaaaaattcca
aatttggaaatagagaagccatcgttagctcatttcggattgccaataaaggatgtttct
aaattagtaaaatatcacatcaacacaagagcaacaaccctcatttacttttattaatta
gaggatagtacaaaatattttgaaactaagcctcttcaatttataaattcgatagtcaga
tcaagacatgatggaggattgtacaattacttagtaagcaagaatctaattgttgatatg
gattctcaaccatttttaggtaataatggttgtttctaattctatttgattgaagttgaa
ctaagtgaaacattgattggtcaataaaaagactatgctctataaattggacaagctata
atctcatattttgaagaataaatacacaagttttatgatgaagagtagaatccaacagac
ttcttagaagaaacctataagactaagaaggctatgtcagatgttcaatttaaattcttg
gagaaagacatagacatattcaaattatctcacaatctgaatacattcccacctaaatat
gtattaaatgcagaaactagctattttaaatatgatcctcaatgtatatataattattta
gctgatctaatgaatcctaataatatgttgattttgattggagatgatggatataaattg
gtgtaagaggaaatagaaaatgaagaattaaaggcctcattcttatcattctaatagcca
tcaactttgttattgcagtagagtgttgctgttagtgatttagatttcatcaactaaaga
gaactccaattttcaaatgatctttatcacatataatatgatgttaaaccattagagaga
gacagtttggatttcatgatgcttgacaacattccattgagtttaccataaattaatcat
tacgtcccagttaatttagcttttaaatcactatgtgaatcacagcagatctcatatatc
taatcggttgattctgacactctgtatgatagaaaaaacagatagaatatattcatagaa
aatactcacaaaatgcctttctatttcacatcaaagaaggagtgttaggagcatgaattt
gaatatgagcaatacaatcatttcccataattgattaagaaggacattgagggtaaaacc
tggtggagattggatagatcatatagtccaactgtgtatgcaggtatgaactttgaaact
gctttggacatgaaatctcttaagaaagtagcattgttaacagtatttaatagttatgtg
tctgataatttatataaatctctttaataatcatttgaagctggttatgaattatcattt
gattcatcaatgaaaggtctatcactcgaaatgtatggatggagtgataaatttgaatac
ttttataagaatgtgttaagagagattaagaatgaaatcagcgatgatgatcttttgaat
agagtgaaactaagtcaaatcactgagttgagtaacacttttgaataaaaattgtttgtc
taagccacttctgtgatattgccaaccataattcaaggttaaccaaccccttcttagatg
atagatgaaatcaattcagtaactaaggaagaattgtctcaattttagaaagaaatgtta
gagaatttcagattcactacctatttcacaggaaatatattgagagatgaagtgtaatca
ttgcaaaatcaaattcccaagatatttgatgaatctacttcacatatcagaattcaaaac
catattacttaagtatcagatctgactcgcaaatccatagtatactcattagtctctaaa
tctactaattaattggacacaaatggagttactctgaattactattaaattgggtacaga
gattagaagtaattagccatgatgaatttattatataagattctccacaatgcagcatat
gcctatttgcgtacacaattgtaattgggttatgttgtaagtgtcaaattcaagccagtt
ggttgtttggacagtgctcaaattttggtgtagggaacagcaaaacctccctatgttgtg
aattaacatatagaagagttcttaattaattatggacgagaattgaaagagatgactgat
caataatttgaagagcttaaaactactactatatctggattgaaagaggtcgagaagaat
ctaaaggacaaagcaagaagcacttggtcgcatattaagaataacgatttggcatttgag
gagaaggaaatcgctgcccaatacattaacatggtcactaagtccgatctcttttcattc
tatgacaaggttttcacttcaggaaagctatccctttaagtgtatggacaaggcatgatc
acttaaaccatgggaatcagtgtcaatgatttagccaataaggtgaaaagcaattctcta
tcgaaagaacaaacgtatgctgtcagggatgaagtcacagtttctacctctgatgatttc
aagcaaagaatcacttcaaattataattgcaattacaagataagtaatatttga

DBGET integrated database retrieval system