KEGG   Paramecium tetraurelia: GSPATT00021522001Help
Entry
GSPATT00021522001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00021522001
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptm03032]
    GSPATT00021522001
   03036 Chromosome and associated proteins [BR:ptm03036]
    GSPATT00021522001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     GSPATT00021522001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: CMGC group
  CDK family
   GSPATT00021522001
DNA replication proteins [BR:ptm03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    GSPATT00021522001
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GSPATT00021522001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 5041080
NCBI-ProteinID: XP_001455295
Genoscope: GSPATT00021522001
UniProt: A0DXY1
Position
undetermined
AA seq 256 aa AA seqDB search
MKPVFSIPSLKFSYGVVRKVFDKQRSKSVGLKGIKLNDEGVPNKTMREKGILQMLKHPNI
TKYFIEQKKIFLKKIQMKINQQIQIGQSESQITQFQVYRIVMRSLTRELFIKWDDSKIAN
FGLSKVFPISIKKFPSEVCIQYRASEILLGDDNEVTSADIWAIGCIIAECLNRQPLFRGD
GQIFIVCNIMFKFLGTPSNDNYFGQSKIPHFRLNFSKFRAENLTSIKPIFDRIQYDEFQE
QKIFKYFLSRIRNFKY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtcttttcaataccttcattaaagttttcctatggggttgtgagaaaagta
tttgataaataacgatctaaatcagtaggcctaaagggaattaagcttaatgatgaaggt
gttcctaataaaactatgagagaaaaaggtatattataaatgttaaaacatccaaatatt
acaaagtattttattgaacaaaagaagatattccttaaaaaaatttaaatgaaaataaat
taatagatttaaattggataaagcgaatcataaatcacataattttaggtttatcgtatt
gtcatgagatctttaaccagagaactttttattaaatgggatgacagtaaaattgcaaac
tttggactgtctaaagtgtttccaatttcaatcaaaaaatttccatcagaagtttgtata
tagtatagagcctcagaaatcctacttggagatgataatgaagtaactagtgctgatatt
tgggctattggttgcataatagctgaatgtttaaatagataaccactctttagaggggat
ggctaaatttttatcgtatgcaatattatgtttaagtttcttggaactccatctaatgat
aactattttggataatctaaaattccacatttcaggttgaatttttcaaaatttagagcc
gaaaatctgacttcaattaaaccaatatttgatagaatttaatatgatgaattttaagaa
tagaaaatttttaaatattttttatctagaattcgcaactttaaatattga

DBGET integrated database retrieval system