KEGG   Paramecium tetraurelia: GSPATT00022475001Help
Entry
GSPATT00022475001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00022475001
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptm03036]
    GSPATT00022475001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     GSPATT00022475001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   GSPATT00022475001
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     GSPATT00022475001
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GSPATT00022475001
  Sister chromatid separation proteins
   Polo kinases
    GSPATT00022475001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 5042486
NCBI-ProteinID: XP_001456701
Genoscope: GSPATT00022475001
UniProt: A0E1Y7
Position
undetermined
AA seq 642 aa AA seqDB search
MDEKTTADGSEQVVIFEEKITKVNGEVAIKRYQRGKFLGKGGFAKCYEATNLETKKVLAA
KIIAKSSLTKNRARQKLISEIKIHKSLQNTNIVQFEHVFEDHENVYILLELCSNQTLNEL
IKRRKRLTEIEVQCYVAQIINALKYLHASNVIHRDLKLGNLFLNKSMELKLGDFGLATKL
EFDGEKKRTICGTPNYIAPEVLDGKVGHSFEVDVWSLGVIIYAMLIGKPPFETPDVKTTY
RKIRLNSYTFPEHVLISDAAKNLITRILNLDPVKRPTLDEIMAHPFMNTGGSIPKTLPLS
TLACPPSASYNKQFQPSTNSSSLKMSVNAMPQRLTETTPNNQKNQQRPGNGSSDRFPLQK
PSSSGNILEDNFGSSGLNNAQNVGYGGSQRPQSQKPNDIRSSQSQKALNTPFGATGMQAT
HSVNNLGQKSPQQKQEIYVKKWVDYSSKYGLGYLLSNGATGVFFNDSTKIILDTRSLQFE
YMERRGTDKQDICESHNLNDYPRDLQKKVTLLQHFRSYLEGEQNKQDMAFEEYDSKQLVY
VKKWMKTRHAIMFRLSNKIVQVNFTDKTEIILSSEHKMVTYVNKTGERSYYPLATALDSQ
NTEMAKRLKYTKEILTHMLNGGHTGDQKPNQMTGTNWQNSGP
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaaaaccacagcagatggttctgagtaggtagtgatctttgaagaaaaaatc
actaaagttaatggggaagtggcaataaaaagatactaaagagggaagttcttaggaaag
ggtggttttgccaagtgttacgaagcaacaaatttggagacaaagaaagttttggctgcc
aagataatagctaaaagcagtttaactaagaacagagctcgttaaaagcttatttcagaa
ataaaaatacacaagagtttgcaaaatacaaacattgtgcaattcgagcatgtctttgag
gatcacgaaaatgtatacattttattagagttatgttccaatcaaactctaaatgaatta
ataaaacgacgcaaaagactaacagaaatagaagtgcaatgctatgttgcatagataatc
aacgcactcaaatacctacacgccagtaatgtgattcatagagatctcaaattaggaaat
ctgttcctcaataagtcgatggaactgaaattgggagattttggtttggcaacaaagttg
gaattcgacggagagaagaaaagaactatttgtggaacacccaattacatagccccagaa
gttttggatggaaaagttggtcactcctttgaagtggacgtctggtcattgggagttata
atctacgccatgttaattggaaaacctccctttgaaaccccagacgtcaaaactacatat
aggaaaatcagattgaattcatatacttttccagaacatgtcctcatatctgatgcagcc
aagaatctcatcacaagaattctgaacttggatccagttaaaagacccactttggatgag
ataatggctcacccattcatgaacacaggtggatctataccaaagacactccccctatct
actcttgcttgtcctccttcagcctcttataataaacaattccaaccatccaccaattca
agtagtctgaaaatgtcagtaaatgctatgcctcaaagattgactgagactactccaaac
aattagaaaaatcagcaaagaccaggcaatggctcatctgatcgtttcccattgtagaaa
cctagctcaagtgggaatatcttagaagacaacttcggatccagtggattgaacaatgca
caaaatgttggttatggtggctcacaaagacctcaatcccaaaaacccaatgacatcaga
agtagtcaaagttaaaaggcactcaacactccttttggtgccactggaatgcaagccact
cattcagtcaataatcttggctaaaaatcacctcaacaaaaataagaaatctatgtgaaa
aagtgggttgactattccagcaaatatggattgggatatctattaagcaatggggccaca
ggagtcttcttcaatgattctaccaaaatcatattggataccagatcactgcaatttgag
tacatggaaagaagaggaactgacaaataggatatttgcgaatcccataatttaaatgac
tatcctagagatctctaaaagaaagttaccttactacaacattttagaagctatcttgaa
ggagaataaaataaacaggatatggcatttgaagaatatgatagtaaacaattagtctat
gttaaaaagtggatgaaaacaagacatgctatcatgtttagattgtccaacaaaattgtc
taagttaatttcactgacaaaacggagattatcttgtcatcagaacataagatggttaca
tacgtaaacaaaaccggagaaagaagttattatcctttagctactgctcttgatagttaa
aatactgaaatggcaaaaagactaaagtatactaaagaaatcttgactcacatgctcaat
ggtggtcatactggagatcaaaaacctaactaaatgactggaaccaattggtaaaattct
ggaccttga

DBGET integrated database retrieval system