KEGG   Paramecium tetraurelia: GSPATT00022726001Help
Entry
GSPATT00022726001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    GSPATT00022726001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     GSPATT00022726001
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     GSPATT00022726001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_2 HEAT Cnd1 Vac14_Fab1_bd Adaptin_N CLASP_N HEAT_EZ DNA_alkylation Arm Gcn1_N RTP1_C1 V-ATPase_H_C DUF1323
Motif
Other DBs
NCBI-GeneID: 5042736
NCBI-ProteinID: XP_001456951
Genoscope: GSPATT00022726001
UniProt: A0E2N7
Position
undetermined
AA seq 573 aa AA seqDB search
MGDNPIDVFKEDMENEEVYLKVNAMHRARIIATLLGTDKIRSVLLPYFETLMKKEDDEVL
FAMAEELGYIAQIIPQQSICLLPILEQLAGFDETVVREQAVKSIAIVCNFLQDNEIANTI
VPMILKLASNEANFTCRVSAVSLMCPMYSRSGNQKEKLRQKFTELCSEETPMVRRAVATK
IGEIAQYMDKNHVIEVLIAVLKQLCQDEQDQVRLLCMESIMNIAKILNINENKTNILPLI
ISSAEDKSWRVRLALSKIFAELAEAVGKEIADSSLIQIFSNLLKDPESDVRVIAVKSLAK
FIKFVSPEKLNLIIPLLQLLAKDAFAQVKQNACLVIGQIATILPKEISQSKLQSYLIELM
SDDNQDVRKNAAQSVGIFAGALGPDALGQFIPHLKKSMEDPKWRVRKETMMTVFHLALTI
KNTDIFLKHLEPVYVLFLKDRAAEVRTIGLSRLNDLIQTYKIDWALGSFLSKCLETLNKD
TGFLYRMNALYAIQQIGVVADGPMIQDKLWPIVQKCMKDNVPNIRFVSIRVAKQLSKKID
HQGTLNQIKQAINELTDDNDRDVKFYAQEALQY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgggtgataatccaatagatgttttcaaggaggatatggaaaatgaggaagtttatctg
aaagtcaatgctatgcacagagctagaattatcgcaacactattaggaaccgataaaata
aggtctgttcttttgccatattttgaaacattgatgaagaaagaagatgatgaagtctta
tttgcaatggcagaagaattaggctatattgcttaaatcattccataataatcgatatgc
ttgttgccaattttggaacaattggcaggatttgatgagactgtggtacgagaataagct
gtcaaatcaatcgcaattgtatgtaattttttataagacaatgaaattgccaacacaatt
gtccccatgattttaaaactagcttcaaatgaggccaattttacctgtagagtctctgcc
gtcagtttaatgtgtcccatgtattctagatcaggaaattagaaagaaaagctcagatag
aaattcaccgaattatgcagcgaagaaactccaatggttagaagagcagtagccactaaa
ataggtgaaatagcataatacatggataaaaatcatgtgatagaagttctgatagctgtt
ttgaaacaattatgttaagatgaataggattaagttagattattgtgtatggaaagcata
atgaacattgctaagattctaaacatcaatgaaaacaagaccaatatcttaccattgatc
atatcttcagcagaagacaaatcatggagagtcagattggctttgtcaaagatatttgca
gagttagctgaagcagtgggtaaagagattgcagactcctcattaatttagatcttttca
aacttactaaaagatcctgaaagtgatgtcagagtaatagctgtgaaaagtttggctaaa
tttatcaagtttgtgtctccagaaaaactaaacctcattattcccttattacaattatta
gcaaaggacgcatttgcataagtgaaataaaatgcttgtttagttattggatagattgct
actattttacctaaggaaattagttaaagcaaactgcaatcctatttgattgaattgatg
agtgatgacaatcaagatgtcagaaagaatgcagcacaatccgttggaatatttgctgga
gctcttggacctgatgcactcggccaatttattcctcatttgaaaaagagcatggaagat
cccaaatggagagttagaaaggaaacaatgatgactgtcttccatttagcattaaccata
aaaaatacagacatattcttgaaacatttagaaccagtctatgtgttatttttgaaggat
agggcagctgaggttagaaccataggattgagcagattgaatgatttaatctaaacttac
aaaatcgattgggcattgggaagttttttgtctaaatgtttggagactctaaataaggat
actggattcttgtatagaatgaatgccttatatgccatctaataaattggtgtagtggct
gatggacctatgattcaagataagttgtggccaattgtttagaagtgcatgaaggacaat
gttcctaatattagatttgttagtataagagtggctaaataattatcaaagaagattgat
catcaaggcactttgaatcaaataaaataagcaataaatgaattgactgatgacaacgac
agagatgttaaattctatgcttaggaagctttacaatattga

DBGET integrated database retrieval system