KEGG   Paramecium tetraurelia: GSPATT00023631001Help
Entry
GSPATT00023631001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    GSPATT00023631001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GSPATT00023631001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   GSPATT00023631001
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     GSPATT00023631001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00023631001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Kinase-like Pox_A22 APH
Motif
Other DBs
NCBI-GeneID: 5043636
NCBI-ProteinID: XP_001457851
Genoscope: GSPATT00023631001
UniProt: A0E587
Position
undetermined
AA seq 359 aa AA seqDB search
MKSKQVIPKGKHAFDCNGQTFIVDDKYQFIKQIGHGAYGVVCSALNKKSQQLVAIKKITD
AFSDLIDAKRIVREIKLLKFFDHENIVSLLDLQRPEHPQNYKDIYIITDLMETDLHRVIY
SKQELTDEHIQYFLYQALRGLLYIHSANIIHRDLKPSNLLLNKNCDLKICDFGLARGYED
ESEFKTEYVVTRWYRAPEVILNASEYNKSVDIYALGCIMAELLGRQPLFPGEDYLDQVQR
IIQVLGTPTNEDVRFIGNKNALTYLKSLPKKPKQQWKNLYPHAQPLALDLLDKMVTFNPD
KRLTVQECLAHPYFEGLHNPEEEPICECTFDWGWDSFKPTEAILKQMVYEESLSFHPLK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctaaataggtgatacccaaagggaagcatgctttcgattgcaatgggtagaca
ttcatagttgatgacaaataccaattcataaagcagattggacatggagcatatggagtg
gtgtgttcagctttaaataagaagagtcagcaattagtggcaatcaagaaaataacagat
gcattttctgatctgattgatgctaagagaatagtgcgtgaaattaaactactaaagttc
tttgatcatgagaatatcgtttcattgcttgatttacaaagaccagaacatccacaaaat
tacaaagacatttacatcattactgatctgatggaaacagatttgcatagagtaatatat
tctaaacaagaattaacagacgagcacattcaatattttctgtatcaagccttaagagga
ttattgtacatacactcggccaacatcatccacagagatctcaaaccaagcaatctgcta
ttgaacaagaattgcgatttgaaaatctgtgattttggattggctcgtggttatgaggat
gaaagtgaatttaaaactgaatatgtagttactcgatggtatagagcaccagaagtcatc
ttgaatgcttctgaatacaacaaatcagtggatatctatgccttggggtgcataatggca
gaactattaggaagacaaccactctttcctggcgaggactatctcgattaagtgcaaaga
atcatacaagtattgggcactcctaccaatgaagatgttcgattcattggaaataagaat
gcactcacctatttgaagagtttgcccaagaaacctaaacaacaatggaagaacttgtat
cctcatgcttagccattggccttggatctgttggataagatggtcactttcaatccagac
aagcgattgacagtttaggagtgtttggcacatccttattttgagggtctacacaatcca
gaggaagaacctatttgtgaatgcacgtttgattggggatgggacagcttcaaacctacc
gaagctatactaaagtaaatggtatatgaggaatcattgtcatttcatccacttaagtga

DBGET integrated database retrieval system