KEGG   Paramecium tetraurelia: GSPATT00024948001Help
Entry
GSPATT00024948001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03030  DNA replication
ptm03410  Base excision repair
ptm03420  Nucleotide excision repair
ptm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GSPATT00024948001
   03410 Base excision repair
    GSPATT00024948001
   03420 Nucleotide excision repair
    GSPATT00024948001
   03430 Mismatch repair
    GSPATT00024948001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptm03032]
    GSPATT00024948001
   03400 DNA repair and recombination proteins [BR:ptm03400]
    GSPATT00024948001
Enzymes [BR:ptm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GSPATT00024948001
    6.5.1.6  DNA ligase (ATP or NAD+)
     GSPATT00024948001
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GSPATT00024948001
DNA replication proteins [BR:ptm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GSPATT00024948001
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GSPATT00024948001
DNA repair and recombination proteins [BR:ptm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GSPATT00024948001
   NER (nucleotide excision repair)
    Other NER factors
     GSPATT00024948001
   MMR (mismatch exicision repair)
    Other MMR factors
     GSPATT00024948001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 5045391
NCBI-ProteinID: XP_001459613
Genoscope: GSPATT00024948001
UniProt: A0EA99
Position
undetermined
AA seq 680 aa AA seqDB search
MQKTIASFFKSSKKGDDSNDQIKEQQFIEENLKKEKLMPEQKVCASKSKSHNMEIKGAVL
FIDMAELYEQVGEIKGQNSKDAIKELVAKLFIRIMKENREEFVPAYLFSILKLGPDYESW
ELGIGQGIIVKSISAVSGKSEKQVRELMNTLGDLGLAIEKSKSTQTSLNKFFVSQSVKEE
VKLTMIQVFNTLQQLQKQEGTGSSLEKERILTGLLRMAKPIEAKYIIRFIEKNLKIGAAE
KTMQAALARAFQLYHKGNVEGDYESIINQALCECPNYKKIIDTLFSIQSLKEVPELCHII
PGVPCKPMLAKPMKSIQMIFQRFENMKFTCEYKYDGLRGQIHFENGQVSIFSRNLENMTQ
TYPDIVNYVHTHYQHLDGFIIDSEIVAYDVANNRILPFQTLTSRAKKNVDQNQIEIQVCL
YIFDLLYLNKQSYLKETLEKRRQTLRETFKEEEGKLKFATSRDSENFEEIEEFLLNSIKM
GCEGLMIKTLEINSQYEPAKRSFNWLKLKKDYLDNGLSDTFDLVPIGACYGTGKRKGFYG
SYLLACYNEDMDQYETTCKIGTGFSDENLEKFFQFFQEYLIPHPLSEYKCDGVNMDVWFS
PVVVWEIKSADIQISPIYSACSTILQLNNKGVGLRFPRLIKVREDKKPNEATSSQFLYDV
YKQQAVVASNNTFEQDDDFY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaacaattgcctcattcttcaaatcaagtaagaaaggagatgattcaaatgat
tagatcaaggaacaacaatttatcgaggaaaacctcaagaaggagaaactgatgcctgaa
taaaaggtgtgtgcctcaaaatccaaatcgcataatatggaaatcaagggtgctgttctt
ttcatcgatatggctgaattatacgaacaagttggagagataaaaggctaaaattcaaag
gatgccatcaaagaattagtagctaaattgttcatcagaatcatgaaagaaaatagggaa
gaatttgtgccggcatacttgtttagcattttgaagttgggacccgattatgagtcatgg
gaattggggattggacaaggaatcatcgtgaaatctatcagtgctgtgtctgggaagagt
gaaaaataagtgagagaactcatgaacacattgggagatttgggtttggccattgaaaaa
tcaaaatcaacatagacatccttaaataaattttttgtttctcaaagtgtcaaggaggaa
gttaaattaacaatgatctaagtattcaacactctccaacaattgcaaaaataagaaggc
acaggaagttcattggagaaggagagaattctgactggtctcttaaggatggctaaaccc
attgaggccaagtacatcatacgattcatagagaagaatctcaagatcggagcagctgaa
aagacaatgcaagctgctttggctagagcattctaattgtatcataagggaaatgtggag
ggtgattacgaaagcataataaattaagcattgtgtgagtgtccgaattacaagaagatt
attgacactctattcagcattcaaagtttgaaggaggttcctgaattatgtcacataatt
ccaggagtgccatgcaaaccaatgttggctaaaccaatgaaatctatatagatgatcttt
tagagattcgaaaatatgaaatttacatgtgaatataaatatgatgggttgagaggtcag
attcattttgaaaatgggcaagtgagcatcttttcaaggaatctagaaaacatgacacaa
acatacccagatattgtcaactatgttcacactcattattaacatttggatggttttatt
atcgattctgaaattgttgcctatgatgtggcaaacaatagaatcttaccatttcaaact
ctaacaagtagagctaaaaagaatgtggattagaatcaaattgaaattcaagtttgttta
tacatatttgatttgctgtatttgaataagcagagttatttgaaagagactttggagaag
agaagatagactttgagagaaacattcaaagaggaggaaggaaagttgaagtttgcaacc
tcaagagattcagaaaattttgaagaaattgaggaatttctattaaattcaatcaaaatg
ggatgcgaaggtttgatgatcaagactttagagatcaattcgtaatatgaaccagccaag
agatcatttaattggttgaaattaaaaaaggattatttagataatggattgtctgataca
ttcgatttagtacctattggtgcttgttatggtacaggaaaaaggaagggattttatgga
agttatttgttagcttgctacaatgaagatatggatcaatatgagactacttgtaagatt
ggtactggattcagcgatgaaaatttagaaaagttcttttaattctttcaagaatacttg
attccacatccattatcagaatacaaatgtgatggagtgaatatggatgtttggtttagt
cctgtggttgtgtgggagatcaagagtgctgacattcagatatcacctatctatagtgct
tgttccactatcttgtaattaaataacaaaggagtggggttgagatttcctagattgatt
aaagtgagggaggacaagaaacctaatgaagccactagttcgcaatttttatatgatgta
tataaataataggctgttgttgccagcaataatacttttgagcaggatgatgatttttat
tga

DBGET integrated database retrieval system