KEGG   Paramecium tetraurelia: GSPATT00028690001Help
Entry
GSPATT00028690001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00028690001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GSPATT00028690001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   GSPATT00028690001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 5010837
NCBI-ProteinID: XP_001425053
Genoscope: GSPATT00028690001
UniProt: A0BGI8
Position
undetermined
AA seq 487 aa AA seqDB search
MKEDMVIERSSQDSLQVTQRSSLLDRKYSGRFTFQKSQEEEQQTQIQSNRNRIKQQLKCQ
LNAIINKQVQPFYMREEQLIELGRKLDLEITSIDVDNIILNTKEFFEDYEIHERLGEGCL
GLVKRIVQKNTGLEFAVKIVATQDDEIIRNMIIEFKRLVELSHDNIVKAYKMYLDFETGF
QSESQAFVIMELIKGKEMFEVINDSGHYSEADAKELFKQLLSAIEYMHRHGICHRDLKPN
NILCLQDRKQIKVTDFNVSKFSDSYKLFGDLRDTQKIEMWTYTGTVAFSAPEIFTGEGYN
QMVDMWSAGCILYSMLSGQLPFNADYLYDLVENIKVAKYDFPEEIFSEVSADAKHLIQQL
LRKDPQERPYPDNALGHSWFRGNVVRKTLRHLTINKNICHLSNKNSNKQRQRTFLLKKDC
YTGSSDGEDENSYYDVKIKTSIRKSLFYYFKPIREQQLDMDQVKRTGGFIGKSNTIQIED
FKYNDQQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggatatggttatagagcgaagttcacaagactctcttcaagttactcaaaga
tcctcgctgttagataggaagtatagtggtcgtttcacgttctagaaatcacaagaggag
gaacaacaaacacaaatttaaagcaatagaaatcgaatcaaacaataactaaaatgccaa
ttgaatgcaataatcaataaacaagtttaacccttttatatgcgtgaggagtagttgatt
gaattgggtcgtaaattggacttggaaataacctcgatcgatgttgacaatattatactc
aacaccaaggagttttttgaagattacgaaatccatgaaagattgggagaaggatgtttg
ggtttagtcaaacgaattgtccaaaaaaatacaggccttgaatttgctgttaaaattgta
gctacttaagatgatgaaattattcgcaatatgattattgaatttaagagactagttgaa
ttatcccatgacaatattgtcaaagcttacaaaatgtacttagattttgaaactggattt
taatcagagagccaagcatttgtcattatggagttgattaaaggcaaagaaatgttcgaa
gtcatcaacgattctggacattatagcgaagctgatgcgaaggaactatttaagcaactc
cttagtgcaatcgaatacatgcatcgacatggcatctgtcacagagatcttaagccaaat
aatattttatgtctataagatagaaagcaaattaaagttactgatttcaatgttagtaaa
tttagtgactcatacaaactttttggagacctgcgggacactcaaaaaatagaaatgtgg
acatatactggcaccgtagctttttcggctcctgaaatattcacaggagaaggttataat
taaatggttgatatgtggagtgcaggctgtatcctttattcgatgctttctggttaattg
ccgtttaatgcagattatttgtatgatcttgtggaaaatattaaagtagccaaatatgat
ttcccagaagaaatcttttcagaagtctctgccgatgccaagcatttaatttagcaatta
ctgaggaaggatccctaagagagaccatatccagataatgctttagggcattcttggttt
agaggcaatgtagtcaggaaaactctaagacacctgactattaataaaaatatttgtcat
ctatcaaacaaaaattcaaataagtaacgatagagaacatttctattgaaaaaagactgt
tatacagggtcaagtgatggagaagatgagaattcttattacgatgttaaaattaaaacc
tccattagaaagagtttgttttactacttcaaacctattcgagaatagcagttagacatg
gactaagtcaaaagaactggtggattcattggcaagtccaatacgatttaaatagaagat
tttaaatataatgattaatagtga

DBGET integrated database retrieval system