KEGG   Paramecium tetraurelia: GSPATT00028854001Help
Entry
GSPATT00028854001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00028854001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GSPATT00028854001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   GSPATT00028854001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pox_A6 APH Choline_kinase RIO1 Clathrin_H_link
Motif
Other DBs
NCBI-GeneID: 5011001
NCBI-ProteinID: XP_001425217
Genoscope: GSPATT00028854001
UniProt: A0BH02
Position
undetermined
AA seq 489 aa AA seqDB search
MQDDRVLERSPQDTLRIPPRLSMMDRKCSGRFTFVKTQAEEQKESVQNNMNRIKQQFRCQ
LNSIINKPIQPLQIREEQLFELGKKLDIEITPSDVENIVPNTKEFFEEYEMHERLGEGCL
GLVKRVVQKKTGQEFAVKIVATQDDEIIRNVNMINEFKRLIKLSHANIVKAYKMFLDFDN
GFQSESQAYVILELIKGKEMFEVINEAGHYSEHDAKELFKQLLSAIEYMHRNGICHRDLK
PNNILCLSDKKLIKVTDFNVSKFSDSYKEFGNLQDTEKIEMWTYTGTVAFSAPEIFTGEG
YNQMVDMWSAGCILYSMLSGQLPFNADYLNDLIESIKLAKYEFPEEIFQEVSSEAKDLIQ
QLLQKDPAMRPHPDEALNHPWFSETFVRKSLRHLTINKNISHLSSRNSNKLKQRTILLKR
GHYAGSSDGEEGYTTEEMKIKGAARKSLFNTAMAPIELQSDNKCLKVQNAVLRKSHTTHI
HDFTQCDEQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtaagacgatcgagttctggagcgtagtccataagatacattaagaatcccaccacga
ttatcaatgatggataggaaatgtagtggtcgttttacatttgtgaagacttaggctgag
gaacagaaggaatcagttcaaaacaatatgaatcgaataaaatagcaatttagatgttaa
cttaactccataataaacaaacccatctaacctctctagataagggaggaacaactattt
gagttgggtaagaaattggacattgaaataacacccagtgatgttgaaaacattgtacca
aatacaaaggagttttttgaagaatatgagatgcatgaaagactgggtgaaggatgtttg
ggattggtgaagagagttgtgtaaaagaagacaggacaagaattcgcagtaaaaattgtg
gctacctaagatgatgagattataaggaatgtaaatatgatcaatgagtttaagagattg
ataaaattatcacatgccaacatagttaaagcatacaaaatgtttttggattttgataat
ggattctaatctgaaagtcaagcctacgtgatattggagctcataaaagggaaagaaatg
ttcgaagtaataaatgaggctggacattacagcgagcatgatgcaaaggaactattcaaa
cagttgctaagtgcaattgaatacatgcatagaaatgggatttgtcatagggatttgaaa
cctaataatatcctctgtctctcagacaagaagttgataaaggtcacagattttaatgtt
agtaaattcagcgattcatacaaggaatttggtaatctttaggacaccgagaaaattgag
atgtggacctatacagggactgtggcattctcagcgccagagatcttcactggggaagga
tacaatcaaatggttgatatgtggagtgctggatgcatattgtactcaatgttgtctggt
taattgccattcaatgcagactatttgaacgatctaattgaatctattaaattggccaaa
tatgagttccctgaagaaatcttttaggaagtctcaagtgaagccaaagatctaatttag
taattgcttcaaaaggatccagctatgagaccacatcctgatgaggctctcaatcatcct
tggttttcagaaacctttgtgagaaaaagtttaagacatctgactataaataaaaacatc
tctcatctttcatctaggaattctaataaattgaaataaaggaccattctcttaaagaga
ggacattatgcaggttctagtgatggagaggaaggatatacaactgaggagatgaaaatt
aagggtgctgctcgaaaaagtctgttcaatactgccatggctccaatagagttgcaatca
gataataaatgcttgaaagtgtaaaatgcagtgcttcgcaagtcacatacaactcatata
catgattttacataatgtgatgaatagtga

DBGET integrated database retrieval system