KEGG   Paramecium tetraurelia: GSPATT00029389001Help
Entry
GSPATT00029389001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00450  Selenocompound metabolism
ptm00970  Aminoacyl-tRNA biosynthesis
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GSPATT00029389001
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GSPATT00029389001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptm01007]
    GSPATT00029389001
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptm03016]
    GSPATT00029389001
Enzymes [BR:ptm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GSPATT00029389001
Amino acid related enzymes [BR:ptm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GSPATT00029389001
Transfer RNA biogenesis [BR:ptm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GSPATT00029389001
 Prokaryotic type
   Other AARSs
    GSPATT00029389001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f DUF3218 DUF5572
Motif
Other DBs
NCBI-GeneID: 5011943
NCBI-ProteinID: XP_001426159
Genoscope: GSPATT00029389001
UniProt: A0BJP4
Position
undetermined
AA seq 842 aa AA seqDB search
MHSFQQQELIELLQSHSNIAIDRQLISQLYNKCMQDQCTIQQFEKVYKDAIQLLSQKIAN
SKQQLIEEQDNLTAIDERLKNNQLISNNNNRTPMRLMLHSASVLNLQVHNKFMVGQYAFY
MKIEDYYEFESDFKPSYNLQFQLNQTIDILDVGDSILLSLNTNTQNQMNTTIVIPTYSLQ
FNKHVTELLAQKENGELLEMEITYEIKVLDQKLLNLQLNQARSLVVSYIKKFEDELEDYS
LQLQDLRQIKIPYNNEIANELNDGQPHHSRQEQSNNTYTIGVPDYYHKPLELQSQDCQLN
PQPQERQSSVIPYLFGIILASFNNIFIDTLFEISFLMIVLIVVLKEDKTTVFTKIMILLS
WIMFGLHLWLHQSVVRIMYVIIIQNLFNFFMIKQIITTPLFYVNAQPHIGHLYSMIYADA
IAKYKSVKLLTGTDEHGLKVYRSAKNQPIQQYCDSISNQFQQLANSFIKYDHFVRTTDPQ
HIMKVQKNWNLLQNNGFILKDTYKGYYCQVEESFVNHKTDQYLEEENYFFKFDKDYLETC
ITKAPSRYQNELKQLIINSICISRPKQRYYWGIEVPNDANQLIYVWLDALLGYLQEEQHH
YMHVIGKDIVRFHALYWPSFLKGINNQSTTELIVHNHWIRNNMKMSKSLGNVIDPFQLLK
TYNQNQIRLYFLTQGPQNMDVSFEEQKLEKCWNTYIDQFNNILFRLFRPKIISPNLLLLQ
QHLLDDQLLQSKQTFLELHKNTKALLDKNLFIEGYLELQKIFVLINTLIDKYQPWKMQVQ
FQKEQFLSFICILISMTQQILDIYVQTPNIISPQFKEFPQNNNVQVTVDLEQDLRLKRFI
IN
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgcattcattttaacagcaagaacttattgaattactttagagtcattcaaatatagcc
atcgatcgtcaattgataagttaattgtataataaatgtatgcaagattaatgcacaatt
tagtaatttgagaaggtttacaaggatgcaatctagttgctgagtcaaaaaatcgccaac
tcaaagtagtaactaatagaggaacaggataatcttacggctatagatgagagattgaaa
aataatcaattgattagcaacaacaataatagaactcctatgagattgatgttacattca
gcctcagtgttgaatttgcaagtgcataacaagtttatggttggataatatgcattttac
atgaagattgaagattactacgaatttgaaagtgattttaagcctagttataatttacag
ttctagctaaatcaaacaatagatattttggatgttggtgacagtattctactgtctttg
aatactaacactcaaaatcagatgaacactacaatagtgataccgacatactccttacaa
ttcaataagcatgtgactgaactactggcatagaaagagaacggggagttgttggaaatg
gaaattacttatgaaatcaaagttttagatcagaaattattgaatctacaattaaactaa
gctcgtagtcttgtagtatcatatatcaagaaatttgaagacgaattggaggattattca
ttgcaattgcaggatttacgatagatcaagataccgtacaataatgagattgcaaatgaa
ttaaatgatggatagcctcatcatagcagataagagtaatcaaataatacatatacaatt
ggagttccagattactatcataaacctttggaactgtagagtcaagactgctaattgaat
cctcaaccttaggagagacaatcaagtgtcataccttacttatttggaataattctagca
tcatttaataacatattcatagataccttatttgaaatatcgtttttaatgattgttttg
attgtggtgttaaaagaagataaaacaactgtgtttaccaaaataatgatcttattatca
tggataatgtttggattacatttatggttgcatcaatcggtggttaggattatgtatgtt
ataattatataaaatttatttaatttttttatgataaaataaataataactacacctttg
ttttatgtgaatgcctaaccgcacataggtcatctctattcaatgatttatgcagatgcc
atcgctaagtataaatcagtaaaattgctgacaggaactgatgagcatggattgaaagtc
tacagaagtgccaagaatcaaccaatccaataatattgtgattccatttccaatcaattc
caacaattagctaattcatttattaaatacgatcatttcgttagaaccactgatcctcaa
catatcatgaaagtttagaagaattggaatctgctctaaaataatggcttcattctaaag
gatacttataaaggatattattgttaagttgaagaatcttttgtaaatcataaaaccgat
caatatttggaagaagagaattattttttcaaatttgacaaagattatcttgaaacatgc
attactaaagcaccatcacgatatcaaaatgaactaaagcaattgattattaatagtatt
tgtatcagcagaccgaaacagagatattattggggaattgaggttcccaatgatgctaac
taattgatttatgtatggttagatgctttgttaggctacttacaagaagagtaacatcac
tatatgcatgtgataggcaaagatatagtcagatttcatgccttatattggccgagcttc
ttaaaaggaatcaataaccaatctacaactgaattgattgtccataaccattggataaga
aataatatgaaaatgtctaagtcacttggaaatgttattgatccattctaattactaaag
acatacaactaaaatcaaattagattatacttccttacttaagggccttaaaatatggat
gtctcattcgaagaacaaaaactagagaagtgttggaatacgtacattgaccaatttaat
aacatcttatttagactattcagaccaaagataatatcaccaaatctactgctattataa
taacatttattggatgatcaattattataatctaaataaacattcctggaattgcacaaa
aatactaaggcattattagataaaaatttattcattgaaggttatttagaactataaaag
atttttgtactcattaatactttaattgataaatattaaccatggaaaatgtaagttcaa
tttcaaaaggagtaatttctaagttttatttgcattctgatatcaatgacttaataaatt
ttagatatttatgtgcaaactcctaatatcataagtccttagttcaaagaattcccttaa
aataataatgtttaagtgacagtggatttagagtaggatttaagattaaaaagattcatc
attaattga

DBGET integrated database retrieval system