KEGG   Paramecium tetraurelia: GSPATT00030026001Help
Entry
GSPATT00030026001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00790  Folate biosynthesis
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GSPATT00030026001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptm04147]
    GSPATT00030026001
Enzymes [BR:ptm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     GSPATT00030026001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSPATT00030026001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a PI_PP_I SRP19
Motif
Other DBs
NCBI-GeneID: 5012575
NCBI-ProteinID: XP_001426791
Genoscope: GSPATT00030026001
UniProt: A0BLH6
Position
undetermined
AA seq 175 aa AA seqDB search
MYRNFTSNNTRTTANLLGLKYLLKDFSDVPTKKFTKLNADEVNQILSIHELNSNWTLNVS
SLVRKYQFQSFQDSFSFMAQVSQIAEQMKHYPKWFNKNGLVTIDLITNEVKGVTFKDVLL
AYTSDHISQIIQQNHSNSIFDNCNIHVENLIQQWNHNYQKSQELNQVIDKSVNFL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtataggaatttcacttctaacaatacaagaactacagctaacctgcttggtttgaag
tatttgttgaaggatttttcggatgtacccactaagaagttcacaaaattgaatgctgat
gaagttaaccaaattcttagcattcatgagttgaactcgaattggactcttaatgtcagt
agtttagttcgtaaatactagtttcagtctttttaagattctttcagttttatggcatag
gtttctcaaatagctgagtagatgaaacattatcctaaatggttcaacaagaatggactt
gtcacaattgatctcataaccaatgaggtcaaaggtgtaacattcaaggacgtactactg
gcctacacatctgatcatatatcttagatcattcaatagaatcatagcaattctattttt
gataattgcaacatccacgttgaaaaccttatccaatagtggaatcacaattattaaaag
agtcaagaacttaaccaagtaattgacaaatctgtgaacttcttatga

DBGET integrated database retrieval system