KEGG   Paramecium tetraurelia: GSPATT00031165001Help
Entry
GSPATT00031165001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase PTPlike_phytase DSPc Y_phosphatase3 Snapin_Pallidin Myotub-related
Motif
Other DBs
NCBI-GeneID: 5014118
NCBI-ProteinID: XP_001428334
Genoscope: GSPATT00031165001
UniProt: A0BQW9
Position
undetermined
AA seq 343 aa AA seqDB search
MQGFLVEGKEISKDYSYDWVQGKAELVAIEKGISVLHFSQELLKRDLEMEFRLLRRLTET
QYHNDNLFDFHPDVQRLNRYNNIIPFKHSIVKLKSEGDEEENLKESYINANFINVIEQFK
QHMATQGPLLSTFGHFWKMIVQENMSMIVMLCNLKENQRAQCEQYWPKNVGETLICGNIQ
VNLQSQDDLGNNITKRILKINQEGEERNVIQIQWCGWPDQGVPSPSDFDVMKELLNIINE
KLLADQKVVFHCSAGVGRTGTLIALSNLMILLRAYKQHIGDDHSSNQSPLFQELEENPEL
YRISIFGMVRRLREQRWGMVHTSEQYSYIYKFIDEAIRYLFNN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtaagggttcttagtagaaggtaaggaaatcagtaaagattattcttatgattgggtt
taaggcaaagctgaattggtagctattgaaaaaggaatttctgttttacacttcagttaa
gaattattaaaaagagatttagaaatggaattcagattattacgtagattaacagaaact
taatatcataatgataatttatttgactttcatcctgatgtacagagactaaatcgatat
aataacatcatcccattcaagcattcaattgtcaaattaaagagtgagggagatgaagaa
gaaaatttaaaggaatcctatattaatgcaaattttatcaatgtaattgaatagtttaag
taacatatggcaacttagggtcctttgctctcaacatttggtcacttttggaagatgata
gtctaggaaaatatgagtatgatagtcatgttgtgcaatttaaaagagaaccaaagagca
taatgtgaataatattggccaaaaaatgttggtgaaacactgatttgtggaaatattcaa
gtgaacttacaaagtcaagatgatcttggcaataatataactaaacgaatactgaaaatt
aatcaggaaggggaggagaggaatgtcattcaaatccaatggtgtggatggcctgactaa
ggagttccttctccaagtgattttgatgtgatgaaggagttattaaatatcattaatgaa
aaattgttggcagatcaaaaagtagtttttcattgcagtgctggagttggaagaactggt
accttgattgcattatcgaacttaatgatcctacttagagcatacaaacaacacattggc
gatgatcattcgagtaattaatcacctttattctaagaattggaagaaaatccagaactt
tatagaatttccattttcggaatggttcgtagattgagagaacaaagatggggaatggtt
catacttcagaataatattcatatatatataaatttattgatgaagctataagatatttg
tttaacaattga

DBGET integrated database retrieval system