KEGG   Paramecium tetraurelia: GSPATT00032687001Help
Entry
GSPATT00032687001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 5016017
NCBI-ProteinID: XP_001430233
Genoscope: GSPATT00032687001
UniProt: A0BWB8
Position
undetermined
AA seq 259 aa AA seqDB search
MQRFESDVNAEGESQAAYTRFESSPSVGRLSDTHVEKQTIIKSTLIASIGSFLFTYGILA
SAGNNMAILVIFFLSILITDRLTVFNPAVSFIDLLMARIGFQEFMFNVIGQVGGSLLGAM
VCFFVLEDFTNAPYLNAKIGDNLLGSVQGESIGSVLFMVVLALQEDDYLKFSDDKLEHAL
VVTLGFGAARVLSSEGQSLFNPAFAFSLELFECIQDGSWGRFGFLWVFTCTPFVAAVVAI
TFNSQVYKRFYDKKIQYGF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtagaggttcgaaagcgatgtgaatgcagaaggggaatcttaagctgcttacacgaga
ttcgaatcatctccatcagttggtcgattgtctgacacacatgtggaaaaataaactatt
atcaaatcaactctaattgcttcaattgggtccttcctctttacttatggcattttagca
tcagcagggaacaatatggcaatcttagtcatattcttcttaagcattctcatcactgat
cgactaaccgtattcaatcctgctgttagtttcattgacttactcatggctagaatagga
ttccaggaatttatgtttaatgttattggctaagtcggaggcagtctcttgggtgcaatg
gtatgtttctttgtcttagaagacttcacgaatgcaccctatttgaatgccaaaatcggt
gacaatctacttggatcagtgtaaggcgaatcgattggctctgttttatttatggtagtc
ttggctttgcaagaggatgattacttgaaattctcagatgataaattggaacatgctctt
gtggtcactctaggatttggtgctgctcgtgtcttgtcatctgagggatagtcactcttc
aatccagcattcgcttttagtttggaattgtttgaatgcattcaggatggttcttgggga
agattcgggtttttgtgggtattcacttgcactcctttcgtggcagcagttgtagcaata
acattcaatagtcaagtgtataagagattctacgacaagaaaatttaatacggattttga

DBGET integrated database retrieval system