KEGG   Paramecium tetraurelia: GSPATT00032993001
Entry
GSPATT00032993001 CDS       T01055                                 

Name
(RefSeq) hypothetical protein
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptm03029]
    GSPATT00032993001
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptm02000]
    GSPATT00032993001
Mitochondrial biogenesis [BR:ptm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GSPATT00032993001
Transporters [BR:ptm02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   GSPATT00032993001
SSDB
Motif
Pfam: Mito_carr RNA_pol_A_bac
Other DBs
NCBI-GeneID: 5016322
NCBI-ProteinID: XP_001430538
Genoscope: GSPATT00032993001
UniProt: A0BX73
Position
undetermined
AA seq 521 aa
MLGTLVVSQPQYEVEKPKYFKFQKLAQQSISLISKFIVIQIVLFSVHQSLLQNKFVITSL
QNIQIKHNKLYQHALILMIKETIMNKIMLNNQNKSQLSQKLKINPFVNSIQKPLNCKFQI
RLINKKEHVIYLNEKTQIKLQAFIRKKINSIEILKGVQCEEKNVMAKLISMNVRENKRNQ
LLKKVLIKQIKSGVIKIRKLMNTQICSKISKRFIFILQMADFIRDFMIGGVSAAVSKTAV
APIERVKLLLQTQDANKKIQEGGAKKYNGIVDCFIRVPKEEGLSALWRGNLANVIRYFPT
QALNFAFKDAYKKLLCPFDPKKERFLFFLGNMASGGAAGATSLMVVYPLDFARTRLAADI
GKKSERQFTGLSDCLSKVYKSDGFIGLYRGFGVSVLGIVVYRGVYFGTYDTAKGTIFKNP
MMNNIIAKFIVAQFITGTAGVISYPLDTIRRRMMMQSGRADILYKNTLDCAVKIAKNEGT
KAFFKGALSNFFRGIGASLVLVLYDEIQQFVAPGSKSSGGE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgttaggtactcttgtggtttctcaaccataatacgaagtcgaaaaaccaaaatatttt
aaattccaaaaattagcttaataaagtatatctttaataagcaaatttattgtgatataa
atagttttattttcggtgcattaatcactgctataaaataaatttgtaatcacatcatta
taaaatatttagataaagcataataaactatatcaacatgctttaattcttatgattaaa
gaaactataatgaataagattatgttaaataattaaaataaatcacaactttcataaaaa
ttgaaaattaatccttttgtaaattcaatttaaaaacccttaaattgtaaattttaaatt
agacttataaacaaaaaggaacatgtaatatatttaaatgaaaagacttaaataaaatta
taagcatttattagaaagaagataaattcaattgagatattgaaaggtgtacaatgtgaa
gagaaaaatgttatggctaaattgataagtatgaatgtaagagaaaataaaagaaattag
cttttaaaaaaggttttaataaaacaaattaagagtggtgtaataaaaataagaaaatta
atgaatacacaaatttgttccaaaatttcaaaaagatttatttttatcttataaatggct
gatttcataagagatttcatgattggtggtgtgtcagccgctgtttcaaagactgctgtt
gctccaattgaaagagtcaaattgttactctaaacctaagatgctaataaaaaaatttaa
gaaggtggtgccaagaaatacaatggtattgtagactgcttcatcagagtcccaaaagaa
gagggcttatctgccttatggagaggtaatttggccaatgtcatcagatatttcccaaca
taagcattgaactttgctttcaaagatgcctacaaaaagctcctttgtccatttgaccca
aagaaagagagattcctcttcttcttaggaaatatggcttcaggtggtgcagctggtgct
acttccttaatggttgtttatccactcgattttgcaagaacaagattggctgcagacatt
ggtaaaaagtctgagagataattcactggattatcagattgtttgagcaaagtttacaag
tctgatggtttcatcggattgtatagaggttttggagtttcagttttgggaattgtagta
tatagaggtgtctattttggtacatatgacacagctaagggtacaatatttaaaaatcca
atgatgaataacattattgcaaaattcattgttgcttaattcatcaccggaactgcagga
gtcatctcatatcccttagatacaattagaagaagaatgatgatgtaatcaggaagagct
gatattctttataaaaatacactcgattgtgctgtcaaaattgctaagaatgaaggaaca
aaagccttcttcaaaggagccctttctaatttcttcagaggaattggtgcttcactcgtt
ttagtcctttatgatgaaatctaacaattcgttgctccaggatctaaatcttcaggaggt
gaatga

DBGET integrated database retrieval system