KEGG   Paramecium tetraurelia: GSPATT00033441001Help
Entry
GSPATT00033441001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptm04131]
    GSPATT00033441001
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     GSPATT00033441001
Membrane trafficking [BR:ptm04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    GSPATT00033441001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC CD20
Motif
Other DBs
NCBI-GeneID: 5016770
NCBI-ProteinID: XP_001430986
Genoscope: GSPATT00033441001
UniProt: A0BYH1
Position
undetermined
AA seq 83 aa AA seqDB search
MYENYKLESYCDICEAYVKENTKHCKHCNRCCQDFDHHCKWVNNCIGDLNYKIFMMMVTS
TMLQFIYTLDCLYQNYNIIQYIE
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaattataaattggaatcttactgcgatatttgtgaagcctatgtgaaagaa
aatacaaagcattgtaaacattgtaatagatgttgtcaagattttgatcatcattgtaaa
tgggtaaataattgcattggggatttaaattataaaatttttatgatgatggtaacgtca
accatgttacaatttatatacacactggattgtttatatcagaattataatattatataa
tacatagaatga

DBGET integrated database retrieval system