KEGG   Paramecium tetraurelia: GSPATT00033500001
Entry
GSPATT00033500001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00230  Purine metabolism
ptm00240  Pyrimidine metabolism
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSPATT00033500001
   00240 Pyrimidine metabolism
    GSPATT00033500001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GSPATT00033500001
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_33 AAA_17 CoaE YvbH_ext KTI12 ABC_tran KAP_NTPase AAA_22 DUF3963
Other DBs
NCBI-GeneID: 5016829
NCBI-ProteinID: XP_001431045
Genoscope: GSPATT00033500001
UniProt: A0BYN0
Position
undetermined
AA seq 246 aa
MDKKFIIVSLEGNVGAGKSTLFEILRQEFPKAIFLMEPLEQWQNVHGNPNLNILEKYYSD
IQRWGFTFQIYAYQSRLMAWDKQLRAVVKEQKLQQIDNQFSSPSTNADDEPILVFTERSI
ESARELFFKLCYNDGTINELEYHIYEEFYEWLMEHYKQYLVDCVIYVNTPPETCLERLTR
RGRQEEACVPLDYLKKLHQRHEDWLSDNTNKFKIINIDATKNYVKDLDIKEAVRRQLIDE
ISTLID
NT seq 741 nt   +upstreamnt  +downstreamnt
atggataagaagtttataattgtatccctggaaggaaatgtgggtgcaggcaaatcaacc
ttatttgagattttgagacaagaattcccgaaggcaattttcctcatggagcccttggaa
tagtggcagaacgtgcatggtaaccccaacctaaatatcttggagaagtactactcagac
attcaacgttggggtttcactttttaaatttatgcttaccaatccagattaatggcttgg
gacaaataattaagagcagtagtcaaagagcaaaaattgtaacagatagacaatcaattt
tcatctccatcaaccaacgctgatgatgaacccatcctcgtatttactgagagaagcatt
gagagtgcaagggaattgtttttcaaattgtgttataatgatggaacaatcaacgaactt
gaatatcacatatacgaagagttttatgagtggctcatggaacactacaagtaatatttg
gtggattgtgtcatttatgttaacactcctcctgaaacatgtttggaacgtttgactcgc
agaggcagacaagaagaagcatgtgtcccactcgattacttgaagaagttacattaacga
catgaggattggctttctgataatactaataaattcaaaatcataaatatcgatgctacc
aaaaactacgttaaggatttggatatcaaagaagctgttcgcagacaattaattgatgaa
atatccactttgattgattga

DBGET integrated database retrieval system