KEGG   Paramecium tetraurelia: GSPATT00034109001Help
Entry
GSPATT00034109001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ptm03019]
    GSPATT00034109001
Enzymes [BR:ptm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     GSPATT00034109001
Messenger RNA biogenesis [BR:ptm03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     GSPATT00034109001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 5017815
NCBI-ProteinID: XP_001432030
Genoscope: GSPATT00034109001
UniProt: Q3SE47
Position
undetermined
AA seq 319 aa AA seqDB search
MQQKLTDLSKYFLDTNERPQNLIKKYKPEERFEDYPKSKELIRLKSELVKKHNHPPNYIK
ADLKTFDLQQLGKFDAILIDPPWAEYTKRLLQANMQLKEHQQSWTLEELKQLQIDKIADI
PSFIFLWCGSEHLDDGRELFKTWGFKRCEDIVWLKTNKDHSKQNQYVAGQDYGDNLFKRV
KEHCLVGLRGDVKRASDQHFIHANIDTDVIITEEEAMGSTKKPEELYEIIERFCLGRKRI
ELFGEIHNIRDGWLTIGSQLRDTRQIPQQYNSYFQQEQFSEEKSFMGPRYLLTTIEIENL
RPKSPPKEMQQQQPQTYFY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtaacaaaagttgactgatttgagtaagtattttttagatacaaatgagaggccttaa
aatcttataaagaaatacaaaccagaagagcgatttgaagattatccgaaatcaaaagaa
ctgattagattaaaatctgagttggtaaagaagcataatcatcctccaaattatataaag
gctgatttaaagacatttgacttgcaataattaggcaaatttgatgcaattctaatcgat
ccaccatgggcagaatacacaaagagattgctgtaggcaaatatgcagcttaaggaacat
taataatcttggactttagaagagttgaaataattataaattgacaaaattgcagatatc
ccaagtttcatcttcttgtggtgtggatctgaacatttagatgatggaagagaattgttc
aaaacatgggggttcaaaagatgtgaggacattgtttggttgaaaactaacaaagaccat
tcaaaataaaatcaatatgttgcaggataagattatggggataatttatttaaaagagtt
aaagaacattgtcttgttggtctgagaggagatgtaaagagagcctctgattaacatttt
atccatgcaaatatcgatactgatgttataataactgaagaggaagctatgggatcgacc
aaaaagcctgaagaattatatgaaatcattgagaggttttgtctagggagaaagcgaatc
gagttgtttggagaaattcataacatcagagatggttggctaactataggctcttaatta
agggataccagataaattccataataatacaattcttatttctagtaggaataatttagt
gaagaaaagtcatttatgggtcctcgatatttattaacaaccattgaaattgaaaacctg
agaccaaaatctcctccaaaagagatgtaataataataaccataaacatacttttattga

DBGET integrated database retrieval system