KEGG   Paramecium tetraurelia: GSPATT00037485001Help
Entry
GSPATT00037485001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptm04131]
    GSPATT00037485001
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     GSPATT00037485001
Membrane trafficking [BR:ptm04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    GSPATT00037485001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Colicin_K DUF2101
Motif
Other DBs
NCBI-GeneID: 5021882
NCBI-ProteinID: XP_001436097
Genoscope: GSPATT00037485001
UniProt: A0CD33
Position
undetermined
AA seq 142 aa AA seqDB search
MCFKNGIFNLLQQDHHCLWVFCQFIIYALLCMSQCVIFITFELFIETSLKGNSKFLCQMR
AFTCLLLCISMGTLLSFHLYYIARNVTTVEFHIEEMKTDNPFRKSRMVDNFKELFGSLYI
NWIFPLTENESKTNIQNDSFEL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttaagaatggtattttcaatttgcttcaataggatcatcattgtttatgggtt
ttttgctaattcataatctatgcgttgctctgtatgtcataatgtgttatattcattacc
tttgaactgtttattgaaacttcacttaaaggaaattcaaagtttctttgccaaatgcgt
gcatttacatgtttacttctttgtatctctatgggaactcttctgtcatttcacctatat
tatattgcaagaaatgtgacaacggttgaatttcacatagaagaaatgaaaactgacaat
ccatttcgaaagtcaagaatggtagacaattttaaagaactctttggttcactttatatc
aattggatttttccattaactgagaatgaaagtaagactaatatttaaaatgactctttc
gaattatga

DBGET integrated database retrieval system