KEGG   Paramecium tetraurelia: GSPATT00037754001Help
Entry
GSPATT00037754001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptm01001]
    GSPATT00037754001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GSPATT00037754001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: Other
  CAMKK family
   GSPATT00037754001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo FTA2 RIO1 Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5022497
NCBI-ProteinID: XP_001436712
Genoscope: GSPATT00037754001
UniProt: A0CEU8
Position
undetermined
AA seq 396 aa AA seqDB search
MGNCGCLKRNDKEFDDFDDKPIKQAPPAVKENTEQQKPTIQFSSHSVPQRQKIKETVNLR
KSHTIEGEKKLNDYTLKQVLGQGTFGKVRLAEKNLQNYAIKILNKSRLKKQREYYTDSNG
VVKIKNAFQNVAKEIAIMKKLRHPNIIRLYEIIDSPNSNKMYMVMEYAQNGQLIEWNEDL
GQFILTHQDFKLTEDKLRIICRDIIKGIYQMHELGIVHRDLKPQNILFDQKFRAKICDFG
VSQIINGDTEYFGTNGTYLFMAPECFSNGLFDRKAVDIWAFGISIYSFAFLTVPFLAVEI
QDIMDLIEQNEIQYPNCRNEFKNFLQKCLNKDPTRRATIKELARDPWLNEGQQIRLQDEI
DQKLMMIEVDETEIQEAYSLATFILIKNWVAKLKHQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggggaattgtggatgtctaaagagaaatgataaagagtttgatgactttgatgataaa
ccgattaaataagcaccaccggcagtcaaagagaataccgaataatagaaacccacaata
taattcagttcgcactctgtccctcaaaggcaaaagatcaaggaaactgtgaatctaagg
aagtctcatactattgaaggcgaaaaaaagcttaatgattacacattaaaataggtttta
ggttaaggtacatttggaaaggttaggcttgcggaaaaaaatttataaaattatgctata
aaaatactaaataaaagcagactcaaaaagcaaagggagtattacactgattcaaatgga
gttgttaagattaagaatgcattttaaaatgtggctaaggagattgctattatgaagaag
ttacgtcatcctaatattattcgactttatgaaattattgattctcctaattcaaataaa
atgtatatggtaatggagtatgcacaaaacggctaattgattgaatggaatgaagattta
ggataatttattttaacacattaagattttaagcttacagaagataaattgagaataatt
tgtagagacattataaagggtatataccaaatgcatgaattaggaatagtgcatagagat
ctaaagccttaaaacattttatttgatcaaaagtttagagccaaaatctgtgactttgga
gtttctcaaattataaatggagacactgagtattttggtaccaatggcacctatttattt
atggctcctgagtgtttttcaaatggtttatttgatagaaaagcagttgatatttgggca
tttggaatttcaatatattcatttgctttcttaacagtgccatttcttgcagttgaaatt
caagacattatggatttgatagagtaaaatgaaattcaatatccaaattgtagaaatgaa
tttaagaattttctgtagaaatgtctaaataaagatccaactcgtagagctacaatcaaa
gaattagcaagggatccatggttaaatgaaggctaacagattcgtttgcaagatgagatc
gaccaaaaacttatgatgatagaagtagatgagacagaaatctaagaggcatattcattg
gctacatttattttaataaagaattgggttgctaaattgaagcattagtga

DBGET integrated database retrieval system