KEGG   Paramecium tetraurelia: GSPATT00038399001Help
Entry
GSPATT00038399001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSPATT00038399001
Enzymes [BR:ptm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GSPATT00038399001
Chaperones and folding catalysts [BR:ptm03110]
 Protein folding catalysts
  Protein disulfide isomerase
   GSPATT00038399001
Membrane trafficking [BR:ptm04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    GSPATT00038399001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GSPATT00038399001
  Exosomal proteins of colorectal cancer cells
   GSPATT00038399001
  Exosomal proteins of bladder cancer cells
   GSPATT00038399001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 Thioredoxin_2 OST3_OST6 AhpC-TSA Calsequestrin DAG_kinase_N TraF
Motif
Other DBs
NCBI-GeneID: 5023479
NCBI-ProteinID: XP_001437694
Genoscope: GSPATT00038399001
UniProt: A0CHN0
Position
undetermined
AA seq 483 aa AA seqDB search
MKSLILISLLLATSLCAFQEEDNVLVLTTDTFQDAIDTFKFIMVEFYAPWCGHCKKLAPE
YSAAAAELKKIGGDNYVPLAKVDATAEASVAEKFSIQGYPTIKFFISGQAIDYEGGRTTN
EIVAWINKKSGPPSTELNTVEDIEKFLERVSSTPILVYFGSTTDNNDYNTFIELAQQNDK
VTFAHTLNLELAEKYNVRGKIVLFKSFDEKRNDFDQSVTLPNLESFINSYANPILLPFND
KAINIVFQQRNNAVILFTDDSDAGVAAFDAFAAVAGSFKDRIKFSYSKPNDGSGLFHRLA
EYIGASTTNVPNVMLYDQLGGNGKYRFEGEITTESLRTFLTNFFDGSLTRYMKSEEVPAT
NDEPVKIVVGKNFKDLVLNNDKDVLIEFYAPWCGHCKQLAPIYEGLAKKLLVNPNIIIAK
CDATANEIEGVNIESFPTIKFWKNGQKNQIIDYSSGRDEANFISFLKENTSHQWVDLDRV
EEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattgatattaatcagcttgttattagctacatctttgtgtgcattctaagaa
gaggataatgtattggtgttaacaacagatacattttaagatgctatcgatactttcaaa
ttcataatggttgagttttatgcaccctggtgtggacattgcaagaagttggctcctgag
tattctgctgcagctgctgaattgaaaaagattggaggagacaattacgtgcctttggca
aaggttgatgctacagctgaagcatcagtggctgaaaaattctccatctaaggatatcca
acaataaaattcttcattagtggtcaagcaattgattatgaaggaggaagaacaacaaat
gaaattgttgcttggattaacaagaaatcaggacccccatctacagaattaaatacagtc
gaagacatcgaaaaattcttagaaagggtatcaagtactccaattcttgtctattttgga
tcaacaacagacaataatgattataataccttcattgaacttgcataatagaatgataaa
gttacattcgcacacaccttaaatttagaattagctgagaaatacaatgttagaggaaag
atagtcctcttcaaatccttcgatgagaagagaaacgattttgattaatcagtgacatta
cctaacttagaaagtttcataaatagctatgctaatccaatcctcttaccattcaacgat
aaagcaatcaacatcgttttctaatagagaaacaacgccgtcattttattcacagatgat
tctgatgctggtgttgctgcattcgatgccttcgctgccgttgccggttcattcaaagat
agaatcaaattctcatactccaaaccaaatgatggatcaggtttattccacagattagct
gaatatattggtgccagcactactaatgttcctaatgtgatgttatatgactaattggga
ggaaatggtaaatacagattcgaaggtgaaatcacaactgaatcattaagaaccttctta
acaaacttctttgacggatcattaacaagatatatgaaatcagaagaagtacctgctacc
aatgatgaaccagttaagattgttgttggcaaaaacttcaaagatttagtcctcaataat
gataaggatgttttgattgaattctatgctccttggtgtggtcattgcaaacaattggct
ccaatttatgaaggtttagctaagaaattgttagttaatccaaatatcattattgctaag
tgtgatgctacagctaacgagattgaaggtgtcaatattgaatcattcccaacaatcaaa
ttctggaagaatggataaaagaattaaatcatagattatagcagtggaagagatgaggcc
aacttcatttccttcttaaaagaaaacacttcacattaatgggttgatcttgatagagta
gaagaattatga

DBGET integrated database retrieval system