KEGG   Paramecium tetraurelia: GSPATT00039140001Help
Entry
GSPATT00039140001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 NAD_Gly3P_dh_C Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5029573
NCBI-ProteinID: XP_001443789
Genoscope: GSPATT00039140001
UniProt: A0D025
Position
undetermined
AA seq 377 aa AA seqDB search
MSKKIKISQPLPKVNWKDTDMEEELTIKIPHGDLINKIIDPRSSPQEFFVPLRFPAQQHM
KDADGFFIPLPKEDPKKILQQQQQFQNERYQIQLQDLISIDDLGQGSSGRVIKALHRPTN
LLVALKTIQIVNDEKFTKQINLELETLVSCNHSNIIRCYGAFLEGAQVAIALEYMNLGTL
QDVIKKSGKIPEGMLGLIAYQLLKGLDYLHRTKKIIHRDIKPSNLLINSQGEVKISDFGV
SGQLLNTQDQRCTWVGTVTYMSPERFLCEPYSSNTDVWSLGLSLLECAWGVFPYPHPGTN
DTTHSLGFWEIKEYIVSRPAPPSPPDFSQIGADFIASCLQKDPRQRRSAAELLEHPFIKQ
FEDVSLQYLEGWLNINQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaattaaaatttcttaacctctaccgaaagtcaattggaaagatactgat
atggaagaagaactcaccatcaaaatacctcatggtgatctaatcaacaaaatcatagac
cctagatcaagtcctcaggaattctttgttccattaagatttccagcctaataacacatg
aaagatgcagatggctttttcatacccttgcctaaggaagatccaaagaaaatactataa
caatagcaacaatttcaaaatgaaagatattaaattcaattgcaggatttgatatccatt
gatgacttgggtcaaggctcaagcggaagagtgatcaaagcattacatagacccactaat
ttgcttgttgcacttaaaacaatccaaatagtgaatgatgaaaaattcactaaataaatc
aatttggaactggaaactttggtcagttgcaatcattcgaacatcatcagatgttatgga
gcttttctagaaggagcttaggtagcaatcgctttagaatacatgaatttaggcactttg
caagatgtaattaagaagtcaggaaaaatccctgaaggcatgttaggactcattgcctat
taactactcaaaggtttggactatttacatcgaacaaagaaaatcatccatagagatatc
aagccttcaaatttattgataaatagttaaggggaagttaaaatctctgattttggtgta
agcggctaattactaaacacctaagaccagcgatgtacttgggttggtacagttacttat
atgtctcctgagagatttctgtgtgagccctactcttcgaatacagatgtctggtcctta
ggactctctttacttgaatgcgcttggggggttttcccttatcctcatcctggaaccaac
gatactactcactcccttgggttttgggaaatcaaagaatacattgtttcaagaccagct
cctccatcacctcctgatttttcctaaattggagctgacttcatagccagttgtttataa
aaagatccaaggtagaggaggagtgctgcagaattgctggaacacccttttattaaacaa
tttgaggatgtgagtctacaatatttagaaggttggcttaacattaattaatga

DBGET integrated database retrieval system