KEGG   Paramecium tetraurelia: GSPATT00039454001Help
Entry
GSPATT00039454001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K18024  tyrosine-protein phosphatase non-receptor type 12/18/22 [EC:3.1.3.48]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptm01009]
    GSPATT00039454001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     GSPATT00039454001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    GSPATT00039454001
Cell adhesion molecules [BR:ptm04515]
 1. Cell adhesion molecules (CAMs)
  Immunoglobulin Superfamily
   Neural system
    Enzymatic CD
     PTPRM; protein tyrosine phosphatase, receptor type, M [KO:K05693] [EC:3.1.3.48]
      GSPATT00039454001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase PTPlike_phytase Y_phosphatase3 DSPc CDKN3
Motif
Other DBs
NCBI-GeneID: 5034553
NCBI-ProteinID: XP_001448767
Genoscope: GSPATT00039454001
UniProt: A0DEA3
Position
undetermined
AA seq 494 aa AA seqDB search
KIQQTQSQFCNYSQKQDDEQRDDLKLDLHYLMQHYQIQIVNSKKQYEGKTQRNEKKLKKG
KIQAQLKHRLQIYLDTVSFLYYNSIRMQLNLKERENTLSQIGFVIVKSENKVERGEPTNI
DLQIILVEYQIQKCLNMNNNILSQKLNNMLQNLQVEGKEINQDYSYEWVVGNDDLINMEK
GISIAEFTEQSQNRDQEMEFRILRRLTETQYHNENLYDFHPDILKLNRYGNILPFKHSIV
KLKCDEEENQKESYINADYINLINGKEKMMIATQGPVTQTIGHFWRMISQENIQSIVMLC
NLKENGKVQCEQYWPRNIGESLLVGNITINFVSQEDLGNNIIKRTLQMQEQNGEEKQIIH
LQWCGWPDQGVPNHNDFNIIMELINQILDKVLNDQKVVFHCSAGVGRTGTLISLVNLMII
LTTYKSHIGIDNASTIILIKQEIFENPDQFRISVFGVVRRLREQRWGMVHTSEQYQYVYK
FIDQAIKYMFQQQQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
aaaatttagtagacccaatcccaattttgcaactattctcaaaaataagatgatgagtaa
cgtgatgatttaaaacttgatctacactacttgatgcaacattactaaatatagattgtt
aattcaaaaaagtaatacgaaggaaagacgcaaagaaatgaaaagaagttaaaaaaagga
aagatataagcctaattaaaacatagactataaatttacttagacacagttagctttcta
tactacaattctatcagaatgcaattgaacttaaaagagagagaaaacaccttaagtcaa
atcgggtttgtgattgttaagagtgaaaataaagtggagagaggagaaccaacaaatatt
gatttataaattatcttagttgaatactaaattcagaaatgtttgaatatgaataataat
attttatcataaaaattaaataatatgctctaaaatttataagttgaaggtaaagaaatt
aaccaagattactcttatgaatgggtagttgggaatgatgatttaataaacatggaaaaa
ggaatttcaatagccgagttcactgagtaaagtcagaatcgagattaagaaatggaattc
agaattttaagacgtcttacagaaacctaataccacaatgaaaacctatatgattttcac
cctgacattttgaagttaaaccgatatggcaacatcttaccttttaaacattcaatagtc
aagttgaaatgcgatgaagaagagaactaaaaggaatcatatataaatgctgattacatt
aatctaataaatggaaaggagaaaatgatgatagccacttaaggtccagtgacctaaaca
ataggacatttttggaggatgatttcttaagaaaatatataaagcattgtaatgctttgt
aatctaaaagaaaatggaaaggtgtaatgtgagtaatactggcctagaaatataggagag
agtttacttgtaggaaatattactataaatttcgttagttaagaagatttgggaaacaat
ataataaaaaggactctgtaaatgtaagaacaaaatggagaagaaaaataaataattcat
ttataatggtgtggatggccagattaaggagtgcccaatcataacgacttcaatataata
atggaattgattaatcaaattttggacaaggtcttgaatgattagaaagtagtatttcac
tgcagtgcaggagtagggagaacaggaacgctgatatccttggtaaacctgatgatcatt
ctcacaacctacaaatcacacataggaattgacaatgcgagtacaataatattaataaag
caagaaatatttgagaacccagattagtttcggatttcagtttttggagtagtgcgaaga
ttgagagagtaacgatggggaatggtgcacacatcagaacaataccaatatgtatacaaa
ttcattgattaagctataaaatatatgttctagcaatagtaatga

DBGET integrated database retrieval system