KEGG   Paramecium tetraurelia: PTMB.136Help
Entry
PTMB.136          CDS       T01055                                 

Definition
(RefSeq) DHHC-type Zn-finger containing protein
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
ptm  Paramecium tetraurelia
Brite
KEGG Orthology (KO) [BR:ptm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptm04131]
    PTMB.136
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     PTMB.136
Membrane trafficking [BR:ptm04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    PTMB.136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 2898601
NCBI-ProteinID: XP_001346961
UniProt: Q6BG86
Position
MT
AA seq 227 aa AA seqDB search
MMLFWALYRTWTIDPGFIPKHTLVDYDETRQRDYCLQCRIKRPERSHHCSKCKRCVLNMD
HHCVWTANCIGLYNRKFFLLILFWGSVGMFQATLLGITNIYALWNRIWVYDSLDFNKVKA
GFIFLLTFSQFLNGFGLYYFFWNNFKLIAINICTLDQMILEIEATTKRKYHTDLTIYNLG
FWYNFYFYFGKNPLLWFIPVGRPLGDGYNWDKRVSSREMSENAIQIE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattctgggcactatatagaacatggacaattgatccaggatttattcctaaa
catacattagtagattatgatgaaacaaggcaaagagattattgtttgtagtgcagaata
aagagacctgaaagatctcaccattgttctaaatgtaaaagatgtgtattaaatatggat
catcattgtgtttggacagctaattgcataggtctatacaacaggaagtttttcctactt
attttattctggggttctgttggtatgttttaagccactttgcttggaataactaacata
tatgccctttggaataggatttgggtctatgattcattggattttaataaagtcaaggct
ggattcatatttttattgacattctcacaattcctaaatggctttggcttatattatttt
ttttggaataatttcaaattgattgccattaacatttgcacacttgattagatgatttta
gaaatcgaagctacaactaaaagaaaatatcataccgatttaactatttataatttagga
ttttggtataacttttatttttattttggcaaaaatccattactttggtttatacctgtt
ggaagacccctaggtgatgggtataattgggataagagggtcagttcaagagagatgtca
gagaatgctatataaatagaatga

DBGET integrated database retrieval system