KEGG   Pseudoalteromonas translucida: PTRA_a0163Help
Entry
PTRA_a0163        CDS       T04220                                 

Gene name
rplV
Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PTRA_a0163 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ptn03011]
    PTRA_a0163 (rplV)
Ribosome [BR:ptn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PTRA_a0163 (rplV)
  Bacteria
    PTRA_a0163 (rplV)
  Archaea
    PTRA_a0163 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: ALS31547
UniProt: A0A0U2WI54
Position
I:158444..158776
Genome map
AA seq 110 aa AA seqDB search
MQALAKHKFASGSAQKARLVADQIRGLPVDRALEILAYSPKKAAVLVKKVLESAIANAEH
NEGADIDELRITTIFVDDGPTMKRIMPRAKGRADRILKRTSHITVMVSDS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattagctaaacataaattcgcctctggttcggcgcaaaaagcacgtctagtt
gcagatcagatccgcggactaccggttgatcgcgcactagaaatcctggcgtacagcccg
aaaaaagcggctgtattagtaaagaaagtacttgagtctgctattgctaacgcagagcat
aacgaaggtgctgacattgatgagcttcgtataacaacgatctttgtggacgatggtcct
acaatgaaacgtattatgccacgtgctaaaggacgcgcagaccgcatccttaagcgtaca
agccatatcactgttatggtttcagatagctag

DBGET integrated database retrieval system