KEGG   Pseudoalteromonas translucida: PTRA_a2294Help
Entry
PTRA_a2294        CDS       T04220                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PTRA_a2294 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptn03400]
    PTRA_a2294 (recD)
Enzymes [BR:ptn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PTRA_a2294 (recD)
DNA repair and recombination proteins [BR:ptn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PTRA_a2294 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_19 AAA_30 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 SH3_13 AAA_22 DUF2075 UvrD-helicase UvrD_C AAA_28 AAA_16 NTPase_1 Mg_chelatase T2SSE CbiA AAA_24 AAA FtsK_SpoIIIE SRP54 MeaB
Motif
Other DBs
NCBI-ProteinID: ALS33400
UniProt: A0A0U2WYI5
Position
I:complement(2122574..2124583)
Genome map
AA seq 669 aa AA seqDB search
MSELNNQPGLFDQEFDQGVEQELELNEQSPTLSTAVPLLTYLLSENRIRIVDVKLAEMLS
KSNSENTHNEMFYLVLLLCLSQQSQHSCLTLSEVDWSNPFNLRRSDFIKAQESVPDKLSP
FSEGFNYEQVLSYLQNHTSVGDNKPLQLFNQRLYFARLAGYEQTLASRLLTMSERTLNIN
NELLAALLNEYFTPDATITTDWQKVACAIAATKGFSVITGGPGTGKTTTVTKLLAILQSL
YKTAPLSIKLVAPTGKAAARLSESILGAKDKLTNIPADIKMLIPESAQTIHRLLGVRPFT
NKFRHNKANPLHLDVLIIDEASMVDLSLMAKLIEALPAHARLILLGDKDQLASVDTGSVM
SDLCQGLVLGQTPGYSPARCDELNNLCFNGEAKLMAQGNSAFKLADCIAFLQHSYRFDAQ
SGIGQLALAVNTNNTGILNYVEQESVEGRFKDVILDYDFIAKPIEKLVKSAASKYTHYLS
LIAQGASVAEVHKAFASYQLLAAVREGDYGVNSLNQRIERVLQQQGLITLSPNQRHYTGM
PIMVSQNDYQLKLFNGDIGILMPDESGQLKALFIGEQGNQRAFSPARLPAHDKVYVMTIH
KSQGSEFSYTAMVLPPLKQARMGINRQLVYTGITRAKNTFELVADKKVLLLAMNKSVSRA
SGLYERLVN
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattaaataatcaaccgggcctttttgatcaagaatttgatcaaggggtagag
caggagcttgagctaaatgagcaaagccctactttaagcacagcagtgcctttacttacc
tatttacttagcgaaaaccgcattcgcattgtggatgtaaagctagctgaaatgctcagt
aaaagtaatagcgaaaacacgcacaatgaaatgttttatctggtgctattactgtgttta
tcgcagcaaagccagcatagttgtttaaccttaagcgaggttgattggagtaaccctttt
aatttacgccgcagcgactttattaaagcacaggagagcgtgccagataagctaagcccg
tttagtgaagggtttaattatgagcaggtacttagctatttacaaaaccatacaagcgtt
ggagacaacaaaccactgcaactgtttaatcaacgcctttactttgcgcgccttgctgga
tatgagcaaacattagcgagccgtttactaacaatgagcgagcgtacacttaatataaat
aatgagttattagctgcgctacttaatgagtattttacacccgatgcaaccattaccacc
gattggcaaaaagtagcctgtgctattgcagccaccaaaggttttagcgttattactggc
ggcccaggtactggtaaaacgaccacagtgactaagttgctcgccattttacagtcgctt
tataaaactgctccactgagtattaagctggtggcacccacaggtaaagccgcagcgcgc
ttaagcgaatcaattttaggcgctaaagataagctcactaatatacccgctgatattaaa
atgttaatccccgaaagtgcacaaactattcaccgattattaggggtaagaccctttacc
aataagtttaggcacaataaagcgaatccactgcatttagatgtgttaattatagatgaa
gcctcaatggtcgacttatcgctgatggcaaaactaattgaggcattacctgcacatgca
cggttaatactcttaggtgataaagatcagctggcctcggtagacaccggcagcgtaatg
agtgacttatgccaagggctagtactggggcaaacacctggttattcaccggcacgatgc
gatgagctaaataatttatgctttaacggcgaggctaaattaatggcgcaaggtaatagc
gcgtttaaacttgccgattgcattgcatttttacaacacagctaccgctttgatgcacaa
agtggtattggccaacttgcgttagcggtaaataccaataacacaggtattttaaattac
gttgagcaagaaagtgttgaggggcgctttaaagatgtgattttagattacgactttata
gctaaacctatcgaaaaattggttaaaagcgctgcaagtaaatacacacattatcttagt
ttaattgctcaaggtgcaagcgttgcagaggtgcacaaagcctttgcaagttaccagtta
ctggccgcagtacgtgaaggtgattacggggttaatagtttaaatcagcgtattgagcgc
gttttacaacaacaagggcttattaccctaagcccgaatcagcgccattataccggtatg
ccaataatggtaagccaaaatgattatcagcttaagttgtttaatggcgatattggtatt
ttaatgcccgatgaaagcggccagcttaaagcactatttataggcgagcaggggaatcaa
cgggcgttttcgccagcacgcttacctgcgcacgacaaagtatatgtaatgactatacat
aaatcacagggatcagagtttagctacaccgccatggtgttaccgccgctaaaacaagcc
cgcatggggataaataggcagttagtgtataccggcataacgcgtgctaaaaataccttt
gagctggtggcagataaaaaagtattgttactggcaatgaataaaagtgtgtctagagca
tctggtttatatgagcgtttagtaaattaa

DBGET integrated database retrieval system