KEGG   Pseudoalteromonas translucida: PTRA_a2581Help
Entry
PTRA_a2581        CDS       T04220                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00071  Fatty acid degradation
ptn00072  Synthesis and degradation of ketone bodies
ptn00280  Valine, leucine and isoleucine degradation
ptn00310  Lysine degradation
ptn00362  Benzoate degradation
ptn00380  Tryptophan metabolism
ptn00620  Pyruvate metabolism
ptn00630  Glyoxylate and dicarboxylate metabolism
ptn00640  Propanoate metabolism
ptn00650  Butanoate metabolism
ptn00900  Terpenoid backbone biosynthesis
ptn01100  Metabolic pathways
ptn01110  Biosynthesis of secondary metabolites
ptn01120  Microbial metabolism in diverse environments
ptn01130  Biosynthesis of antibiotics
ptn01200  Carbon metabolism
ptn01212  Fatty acid metabolism
ptn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTRA_a2581 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PTRA_a2581 (atoB)
   00640 Propanoate metabolism
    PTRA_a2581 (atoB)
   00650 Butanoate metabolism
    PTRA_a2581 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PTRA_a2581 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PTRA_a2581 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PTRA_a2581 (atoB)
   00310 Lysine degradation
    PTRA_a2581 (atoB)
   00380 Tryptophan metabolism
    PTRA_a2581 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PTRA_a2581 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PTRA_a2581 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PTRA_a2581 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptn04147]
    PTRA_a2581 (atoB)
Enzymes [BR:ptn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PTRA_a2581 (atoB)
Exosome [BR:ptn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTRA_a2581 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALS33655
UniProt: A0A0U2WF32
Position
I:2429814..2431019
Genome map
AA seq 401 aa AA seqDB search
MREAVIVSTARTPMGKAFRGAFNDTEAPALSGHAVEQAVKRAGIDGAEVDDVIIGCAAQQ
GTQGYNLGRLTATAAGLPNSVPGMTLDRQCSSGLMSIGFAAQNIMLGSMDIVVAGGVESI
SMVQNKHKNTYRNISKKVLSHSEHAYMQMIETAEVVAKRYNISRLAQDEYSLQSQLRIAA
AQKNNLFDNEIVPMASTKSVFNRETKEVTFEDVLLAKDEGNRPSTTLESLQSLEPVWKDG
RVISQGEFITAGNASQLSDGASACVVMDSQLAAQKGLAPMGVFRGMAVAGCEPDEMGIGP
VYAIPKLLKQHGLSIDDIGLWEINEAFACQLIYSRDYLGIDNNKLNVNGGAIAIGHPFGM
SGARMVGHALIEGKRRGVKYVVVSMCIGGGMGAAGLFEVCL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagcagttatagtttctaccgccagaacgcctatgggcaaagcctttcgtggt
gcctttaacgataccgaagcgcctgcattatcaggtcatgcggttgagcaagccgttaaa
cgcgcgggtattgatggtgcagaagttgatgatgtgatcattggttgtgcagcgcagcaa
ggtactcaaggctataacttgggccgtttaacggcgaccgctgcaggtctgcctaatagc
gtgccgggtatgacccttgaccgtcagtgttcgtctggattaatgagtataggttttgcg
gcgcaaaatattatgcttggttcaatggatattgtggttgccggtggcgttgaatctatt
tctatggtgcaaaacaaacacaaaaatacttatcgtaatatttctaaaaaagtactgtcg
cattcagagcatgcctatatgcagatgatcgaaaccgcagaagttgttgcaaaacgctac
aacatttcacgtttagcacaagatgagtacagcttacagtctcagctgcgtattgcagcg
gcgcaaaaaaataatctgtttgataatgaaattgtgccaatggcatccaccaaatcagta
tttaaccgcgaaaccaaagaggtaacctttgaggacgtattgctagctaaagatgaaggt
aaccgcccttctacaactctcgagagcctacaaagcttagagccggtttggaaagatggt
cgcgttatttcacaaggtgaatttattacagcaggtaatgcaagtcagttatctgatggc
gcgtctgcttgtgtggtaatggactcacaattagcggcgcaaaaaggcttagcgccaatg
ggggtgtttcgtggtatggcggttgcaggttgcgagcccgatgaaatgggtattggccct
gtgtatgctattcctaagctattaaaacaacatggtttatcaattgatgatattggttta
tgggaaattaacgaagcatttgcgtgtcagcttatttattcgcgcgactacctcggtatt
gataacaataaacttaacgttaatggcggcgctatcgccattggtcatccctttggtatg
agtggcgcacgtatggtgggccatgcccttattgaaggcaagcgtcgcggtgttaaatat
gttgtggtgagcatgtgtattggtggtggcatgggtgcggcaggcttatttgaggtgtgc
ctgtaa

DBGET integrated database retrieval system