KEGG   Pseudoalteromonas translucida: PTRA_a3169Help
Entry
PTRA_a3169        CDS       T04220                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
ptn  Pseudoalteromonas translucida
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PTRA_a3169 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ALS34174
UniProt: A0A0U2XA22
Position
I:2978019..2978408
Genome map
AA seq 129 aa AA seqDB search
MTTSSNIGSPVKVSVETFYVEEQSQPELDKFVFAYSVTIKNHSLCSAKLLSRYWLITDAN
GKEIEVQGEGVVGENPVIAPGESYKYTSGAILDTPVGTMQGHYTLRNEFGTEFKAPINVF
RLACPNILH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagcagtaatattggatcgcctgtaaaggtatctgttgaaacattttatgta
gaagagcagtcgcaacctgaactcgataagtttgtatttgcttattctgtaaccattaaa
aatcacagtttgtgtagcgctaaattactgagccgttattggttaattaccgatgcaaat
ggcaaagaaattgaagtgcaaggcgaaggtgtggtcggcgaaaacccagttatagcaccc
ggcgaaagttataaatataccagtggggcaatactagatacccctgtaggtactatgcaa
gggcattatacgttacgtaacgagtttggcactgagtttaaagcgcctattaacgtgttt
cgtttagcctgcccaaacatactgcactag

DBGET integrated database retrieval system