KEGG   Pseudoalteromonas translucida: PTRA_a3177Help
Entry
PTRA_a3177        CDS       T04220                                 

Gene name
dfp
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00770  Pantothenate and CoA biosynthesis
ptn01100  Metabolic pathways
Module
ptn_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PTRA_a3177 (dfp)
Enzymes [BR:ptn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     PTRA_a3177 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     PTRA_a3177 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein BRCT
Motif
Other DBs
NCBI-ProteinID: ALS34181
UniProt: A0A0U2VL96
Position
I:2983862..2985055
Genome map
AA seq 397 aa AA seqDB search
MINLTNKKIVLGISGGIAAYKCAELVRRLKEHGCSVKVVMTESAKHFITPLTMQAVSGEM
VADSLLDPSAEAAMGHIEFAKWADLILVAPATSNIIAKMAAGIADDLLTTLLLATPAKVA
IAPAMNQQMYAHPATQANLATLKARNVLIWGPGKGEQACGDVGAGRMLEPHELVALCIAK
EQPQLLAGKTITITAGPTREAIDPVRFISNHSSGKMGYALAEAALLLGAKVNLISGPVTI
KAPAGVNLINIESADQLLNESLNYAPHSDAFIGCAAVADYRAATVATQKMKKQGDELTLT
LVKNPDVIAHVANLQQNRPYTVGFAAETQNVANYAKGKLKNKKLDMICANDVSQSDLGFN
SDNNALTLYWHNEQLELPTNSKTAIALTVIQQLAQRI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttaactaataaaaaaatagtgctggggattagcggcggtatagcggcctat
aaatgcgcagaactggttagacgcttaaaagagcatggttgtagtgttaaagtagttatg
actgagtcagcaaaacattttataacccccttaactatgcaagctgtgagcggtgaaatg
gttgcagactccttactcgacccttcagcagaagctgccatgggccatattgagtttgcc
aaatgggccgatttaattttagttgccccagccaccagcaacattatagctaaaatggcg
gcgggcattgccgatgacttactcactaccttattgcttgcaactccggctaaagtcgct
atcgcaccggctatgaatcagcaaatgtatgcccaccctgcaacacaagctaatttagcc
acacttaaagcacgtaacgtgcttatttgggggcctggaaagggtgagcaagcttgtggc
gatgtaggcgctggacgcatgctagagcctcatgagctagttgctttatgtatcgcaaaa
gagcaacctcagttacttgcaggtaaaaccattaccataacagcaggcccgacccgagaa
gccattgatccggtacgttttatatctaatcatagctcaggaaaaatgggttacgcactt
gctgaggctgctttattacttggcgctaaggttaatttaatttcaggcccggtgactata
aaagcccctgctggcgtaaatttgatcaacatagaaagcgccgatcagctattaaacgaa
tcactcaactacgcaccgcactcagatgcgtttattggctgcgccgctgttgccgattac
cgcgcagcaacggttgcaacgcaaaaaatgaagaagcaaggcgatgagcttactcttact
ttagttaaaaacccggatgtaattgcacacgtagctaatttacagcaaaaccgcccttac
actgttggttttgccgcagaaacacaaaatgtagcaaactacgcaaaaggcaaactaaaa
aataaaaaactggatatgatttgcgctaacgatgtatcacaaagtgatcttgggtttaac
tctgacaataatgcgctaaccctgtactggcataatgaacagcttgaattgccaacaaat
agcaaaacagcaattgcgctaacagtgatccaacagctcgctcagagaatataa

DBGET integrated database retrieval system