KEGG   Pseudoalteromonas translucida: PTRA_a3187Help
Entry
PTRA_a3187        CDS       T04220                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00670  One carbon pool by folate
ptn00790  Folate biosynthesis
ptn01100  Metabolic pathways
Module
ptn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTRA_a3187 (folA)
   00670 One carbon pool by folate
    PTRA_a3187 (folA)
Enzymes [BR:ptn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PTRA_a3187 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 IMS
Motif
Other DBs
NCBI-ProteinID: ALS34191
UniProt: A0A0U2IT44
Position
I:complement(2997098..2997577)
Genome map
AA seq 159 aa AA seqDB search
MIAAMANNRVIGLNNTMPWHLPGDLQHFKKITTGKPVVMGRKTFESIGRPLPGRRNIIIT
RNSQYQATGIEVATTPEAALNLVADVEEVMVIGGGNIYQQFLESAQRLYLTFIDLDVEGD
TQFPDYEKAANWQVKDEVKMAADEKNQYSHRFVTLYKSS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcaatggcaaataaccgtgtaattggccttaataatacaatgccttggcat
ttaccaggagacttacagcattttaaaaaaataaccacaggtaaacctgtggttatgggg
cgcaaaacatttgagtctattgggcggcctttaccagggcgtcgtaatataattattacc
cgtaatagccagtatcaagcaactggaatagaagttgctacaacgccagaggccgcgtta
aatttagttgcagatgtggaagaggtgatggtcattggtggtggaaatatttatcaacaa
tttttagaaagtgcgcaaaggctttatttaacctttatagacttagatgttgaaggtgat
actcagtttcctgattacgaaaaagcagcaaactggcaggttaaagatgaagtgaaaatg
gctgcggatgaaaaaaatcaatatagtcatagatttgtaactttatataaaagttcttaa

DBGET integrated database retrieval system