KEGG   Pseudoalteromonas translucida: PTRA_b0438Help
Entry
PTRA_b0438        CDS       T04220                                 

Gene name
ltaE
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ptn  Pseudoalteromonas translucida
Pathway
ptn00260  Glycine, serine and threonine metabolism
ptn01100  Metabolic pathways
ptn01110  Biosynthesis of secondary metabolites
ptn01120  Microbial metabolism in diverse environments
ptn01130  Biosynthesis of antibiotics
ptn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ptn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTRA_b0438 (ltaE)
Enzymes [BR:ptn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PTRA_b0438 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ALS34919
UniProt: A0A0U2WIN3
Position
II:complement(430653..431657)
Genome map
AA seq 334 aa AA seqDB search
MIDFRSDTVTKPSKAMRDIMYNAPVGDDVYGDDESVNQLEAYACERFEFADALFCSSGTQ
ANLLALMAHCERGDEYICGQSAHNYKFEGGGAAVLGSIQPQPIENEADGTLCFDKIAAAI
KPDDNHFANTRLLSLENTIGGKVLALDYLAAARKFVNQHSLSLHLDGARAFNAASDLNVD
ITAITQHFDSVSICLSKGLGAPVGSLLLGSKALISKARRWRKVLGGGMRQAGMLAAAGQY
ALEHNVKRLSDDHANARYLAQQLSTLNGFNVNMKNTTNMVYASCEPNINIQQLAADLKAQ
GILFSPSKQLRLVTHLDITKADIDTFIKVLAAHI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatagattttcgctcagatacggtaactaaaccctctaaagctatgcgcgatataatg
tataacgcccctgtaggcgatgacgtatatggcgatgatgaaagcgttaaccaactagaa
gcttatgcatgtgagcgctttgagtttgctgatgcacttttttgtagctcaggtactcaa
gctaacttattggcgttaatggcacattgtgagcgcggggacgaatacatttgcggtcaa
agtgcccataactataaatttgaaggcggcggcgcagccgttttaggctcaatacaaccc
cagccaattgaaaacgaagcagacggtacactttgctttgataaaatagcggcggcaata
aagcctgatgataatcattttgccaacacccgcttattaagccttgaaaacaccataggc
ggtaaagtacttgctcttgactaccttgctgcggcgcgcaagtttgtaaaccagcacagc
ttatcactacacctagatggtgctcgcgcgtttaatgcagcaagcgatcttaatgtggat
ataaccgccattacccagcactttgattctgtttcgatttgtttatctaaagggttaggt
gcgccggttggctcgttattgctaggttcaaaagcactgattagcaaagcaagacgttgg
cgcaaagtacttggcggcggtatgcgccaagcaggaatgttagcagcagcagggcaatac
gcacttgagcataatgtaaaacgcttaagcgatgatcatgctaatgctcgctacctagca
cagcaattaagtacacttaatggctttaacgttaacatgaaaaacaccaccaacatggtt
tatgccagctgcgagcctaatattaatatacagcagctagcagctgatttaaaagcgcaa
ggaatactgtttagtccaagtaagcaacttaggttagtaactcacttagacataactaaa
gcagatatagacacctttataaaggttttagcggcccatatttaa

DBGET integrated database retrieval system