KEGG   Picrophilus torridus: PTO0345Help
Entry
PTO0345           CDS       T00177                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pto  Picrophilus torridus
Pathway
pto00260  Glycine, serine and threonine metabolism
pto00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01130  Biosynthesis of antibiotics
pto01230  Biosynthesis of amino acids
Module
pto_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO0345
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTO0345
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTO0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAT42930
UniProt: Q6L272
Position
complement(381317..382054)
Genome map
AA seq 245 aa AA seqDB search
MRNLIPYFTLGYPDNETLKRFLMAMPINMINYIEFGFPSNDPRYDGPTIRKTHRIGNENY
DESFYIDIFNYFNDHNIKMYSLSYYSDIKDIERFAAVLSNLGFSGSIIPDLLIDYYDEAF
DVINKLNEMHFEYIPFFTPSTPDNVIKKVSEKTYSWIYYGLQPSTGIDIPYDLDYTCNRI
FSLVKSREINFGFGIKTIEDVSGLIRRGASGVAIGSYLVNMLDGNDLNGFLDYLKRIRGA
LDVES
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttaataccatattttacacttggctatccggacaatgaaaccctgaaaagg
tttttaatggcaatgcccattaatatgataaattacattgaattcggatttccatcaaat
gacccaaggtatgatggcccgacaataagaaaaacccatagaataggcaatgagaactat
gacgaatcattttacattgatatattcaactactttaatgatcataatataaagatgtac
tcgctttcatactattcagacataaaggatatagaaaggttcgctgccgttctatcaaac
ctgggcttttcaggatcaataatacctgatttgttaatagattactatgatgaggccttt
gatgttataaacaaattaaatgagatgcattttgaatacataccgttcttcacgccctca
actcctgataatgtaataaaaaaggtatcagaaaaaacatactcatggatatactatggc
ctgcagccatcaacaggcatagacataccttatgatcttgattatacatgcaacaggata
ttttcacttgttaaatccagggagatcaactttggcttcggcataaagaccattgaggat
gtttcaggtttaataagacgcggggcctcgggcgttgccataggttcatatcttgtaaac
atgcttgacggcaatgacctgaatggttttcttgattatttaaaaaggataaggggtgct
ctcgatgttgaatcttga

DBGET integrated database retrieval system